KEGG   Rattus norvegicus (rat): 85421
Entry
85421             CDS       T01003                                 

Gene name
Prkd1, Pkcm, Prkcm, nPKC-D1, nPKC-mu
Definition
(RefSeq) protein kinase D1
  KO
K06070  protein kinase D [EC:2.7.11.13]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04925  Aldosterone synthesis and secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    85421 (Prkd1)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    85421 (Prkd1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    85421 (Prkd1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     85421 (Prkd1)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CAMK group
  PKD family
   85421 (Prkd1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 PH Kinase-like C1_2 Kdo zf-RING_9 PHD
Other DBs
NCBI-GeneID: 85421
NCBI-ProteinID: NP_001263644
RGD: 620964
Ensembl: ENSRNOG00000004165
UniProt: Q9WTQ1
Position
6q22
AA seq 918 aa
MSAPPLLRPPSPLLPAAAAVAAAAAALVPGSGPAPFPAPGAAPAGGISFHLQIGLSREPV
LLLQDSSGDYSLAHVREMACSIVDQKFPECGFYGLYDKILLFRHDPASENILQLVKIASD
IQEGDLIEVVLSASATFEDFQIRPHALFVHSYRAPAFCDHCGEMLWGLVRQGLKCEGCGL
NYHKRCAFKIPNNCSGVRRRRLSNVSLTGLGTVRTASAEFSTSAPDEPLLSPVSPGFEQK
SPSESFIGREKRSNSQSYVGRPIQLDKLLMSKVKVPHTFVIHSYTRPTVCQFCKKLLKGL
FRQGLQCKDCRFNCHKRCAPKVPNNCLGEVTINGELLSPGAESDVVMEEGSDDNDSERNS
GLMDDMDEAMVQDTEMALAEGQSDGAEMQDPDADQEDSNRTISPSTSNNIPLMRVVQSVK
HTKRRSSTVMKEGWMVHYTSKDTLRKRHYWRLDSKSITLFQNDTGSRYYKEIPLSEILCL
EPAKPSALIPTGANPHCFEITTANVVYYVGENVVNPSSPPPNNSVPPSGIGTDVARMWEV
AIQHALMPVIPKGSSVGSGTNSHKDISVSISVSNSQIQENVDISTVYQIFPDEVLGSGQF
GIVYGGKHRKTGRDVAIKIIDKLRFPTKQESQLRNEVAILQNLHHPGVVNLECMFETPER
VFVVMEKLHGDMLEMILSSEKGRLPEHITKFLITQILVALRHLHFKNIVHCDLKPENVLL
ASADPFPQVKLCDFGFARIIGEKSFRRSVVGTPAYLAPEVLRNKGYNRSLDMWSVGVIIY
VSLSGTFPFNEDEDIHDQIQNAAFMYPPNPWKEISHEAIDLINNLLQVKMRKRYSVDKTL
SHPWLQDYQTWLDLRELECRIGERYITHESDDSRWEQYAGEQGLQYPAHLINLSASHGDS
PEAEEREMKALSERVSIL
NT seq 2757 nt   +upstreamnt  +downstreamnt
atgagcgcccctccgctactacggccgcctagcccgctgctgcccgccgcggccgctgtg
gccgccgccgctgctgcgctggtcccgggctccgggcccgcgcccttcccagcgcctggg
gccgccccggcggggggcatctcgttccatctgcagatcggcctgagccgcgagccggtg
ctgctccttcaggactcctctggcgactacagcctggcgcatgtccgggagatggcttgc
tccatcgtggaccagaagttccctgaatgtggcttctatggactctatgacaagatcctg
cttttccgtcacgatcctgcctctgaaaacatccttcagctggtaaaaatcgcaagtgac
attcaggagggcgatcttattgaagtggtcctgtcagcttcagccaccttcgaagacttc
cagatccggcctcacgctctcttcgttcattcatacagagcccctgctttctgtgatcac
tgtggagaaatgctgtggggactggtgcgccaaggccttaaatgtgaaggatgtggcctg
aattaccataagagatgtgcatttaaaatccccaacaattgcagtggagtgagaaggaga
aggctctcaaatgtttccctcactggactgggtactgtccgcacagcgtctgcggagttc
tccaccagtgcccccgatgagcctctactgtctcctgtgagccctggctttgagcaaaag
tctccatctgagtcatttatcggtcgtgagaagaggtcaaattctcagtcatatgttgga
cggccgattcagctcgacaagctcctgatgtctaaggtgaaggtgccacacacctttgtc
atccactcctacacacggcccacggtctgccagttctgtaagaagctcctcaagggcctc
ttccggcagggtttgcagtgcaaagattgccgattcaactgtcacaaacgctgtgcacca
aaagtaccaaacaactgcttgggcgaagtgaccatcaatggagaattgcttagccctggg
gcagagtctgatgttgtcatggaagaagggagcgatgacaatgacagcgaacggaacagt
ggactcatggatgacatggacgaggccatggtccaggacactgagatggctttggcggag
ggtcagagtgacggtgcagagatgcaggatccagacgcagaccaggaggactccaacaga
accatcagcccttctacgagcaacaacataccgcttatgagggtagtgcagtctgtcaag
cacacaaagaggagaagcagcacagtgatgaaggaagggtggatggtccactacaccagc
aaggacacactgaggaaaaggcattactggagactggacagcaaaagcatcacactcttc
caaaacgacacaggcagccggtactacaaggaaattcctttatcagaaattttatgtctg
gaaccagcaaaaccttcagcattaattcccactggagctaaccctcattgttttgaaatc
actacagcaaacgtagtgtattatgtgggagaaaacgtggtcaacccttcaagcccccca
ccaaacaacagcgtccccccgagcggcatcggtaccgatgtggcgaggatgtgggaggtc
gccatccagcacgctctcatgcctgtcatccccaagggctcctctgtgggttccggaacc
aactcacacaaagatatttcggtgagcatttccgtttcgaatagccagattcaggaaaat
gtggatatcagcacagtctatcagattttcccggatgaggttctgggttctggacagttc
ggaattgtttatggaggtaaacatcgtaaaacaggaagagatgtagctattaagattatt
gacaaattaagatttccaacaaaacaagaaagtcagcttcgtaatgaggttgcaatttta
cagaaccttcatcaccctggtgttgtaaatttggagtgtatgtttgagacgcctgaaaga
gtgtttgttgttatggaaaaactccatggagacatgctggagatgatcctgtcaagtgaa
aagggcaggttgccagaacacataacgaagtttttaattactcagatactagtggctttg
cgacatcttcattttaaaaacatcgttcactgtgacctcaagccagaaaatgtgttgctg
gcatcagcagaccctttccctcaggtgaaactttgtgattttggttttgcccggatcatt
ggcgagaagtctttccggagatcagtggtgggtaccccagcctacctggcacctgaggtt
ctgaggaacaagggctataaccgctcgctagacatgtggtctgttggggtcatcatctat
gtgagcctgagtggcaccttcccttttaatgaagatgaagatatccacgatcagatccag
aacgcagccttcatgtatccacccaatccctggaaggagatttctcatgaagccattgat
cttatcaataacttgctacaagtgaaaatgagaaaacgctacagtgtggacaagaccttg
agtcacccctggctacaggactaccagacctggttagatttacgcgagctggaatgcaga
attggagaacgctatattacccatgaaagcgatgactcgaggtgggaacagtatgcaggc
gagcagggactgcagtatcccgcgcacctgatcaatctgagtgctagccatggcgacagt
cctgaggctgaagagagagagatgaaagccctcagtgagcgtgtcagcatcctctga

DBGET integrated database retrieval system