KEGG   Rattus norvegicus (rat): 85424Help
Entry
85424             CDS       T01003                                 

Gene name
Elf1
Definition
(RefSeq) E74-like factor 1
  KO
K09428  E74-like factor 1/2/4
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    85424 (Elf1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    85424 (Elf1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Elf-1_N Ets
Motif
Other DBs
NCBI-GeneID: 85424
NCBI-ProteinID: NP_445972
RGD: 620697
Ensembl: ENSRNOG00000011762
UniProt: G3V9V2 Q9EQY2 Q9EQY3
Position
15q12
AA seq 615 aa AA seqDB search
MAAVVQQNDLVFDFASNVMEDEQQLGDPAIFPAVIVEHVPGADILNGYAGLACVEEPNDM
ITESSLDVAEEEIIEDDDDDITLTVEASCHNGDETIETIGAAEALLNMDSPGPVLDEKRI
NNNIFSSSEDDIVAPITHVSVTLDGIPEVMETQQVQESNADSPGASSPEQPKRKKGRKTK
PPRPDSPATTPNISVKKKSKDGKGNTIYLWEFLLALLQDKATCPKYIKWTQREKGIFKLV
DSKAVSRLWGKHKNKPDMNYETMGRALRYYYQRGILAKVEGQRLVYQFKEMPKDLIYIDD
EGPSSSTESSDQSLSSTTTSSRNQANRTRMSSSPGIKGGATTILKPGNPKVAKPKDTVEV
GQPSEVLRTVQPSQAPYPTQLFRTVHVVQPVQAIPEEATITSTMQEEAAGSSVQGIRTIQ
ASTQVPVVVSPGNQQLHTVTLQTVPLTTVIASTDPSSGAGPQKFILQAIPSSQPMTVLKE
NVLLQSQKPGSPPSIVFSPTPVQQVLTGSVQSLGNGAVSMASPPNFSATAPVVTFSRSSQ
LAAHPPGTVITSVIKAQETKTPKAEVEKKAEGHLNGDPEEIEQQPQPYVMVVSSSNGFSS
QVAITQNELLEPSSF
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgttgtccaacagaacgacctagtgtttgactttgcaagcaacgtcatggag
gatgaacagcagcttggcgaccctgccatatttcctgctgtcattgtggaacatgttcct
ggtgctgatattctcaatggttatgccgggctagcctgtgtggaagaacccaatgacatg
attactgagagctctctggatgttgctgaagaagaaatcatagaggatgacgatgacgac
atcacccttacagtcgaggcctcttgtcacaatggagatgagaccattgagaccattggg
gctgctgaggcgctcctcaatatggactctcctggccctgtactggatgaaaagcgaatc
aataataatatatttagctcttctgaagatgacatcgttgccccaatcacccacgtgtct
gtcacactggatgggattcctgaggtgatggaaacccagcaagtgcaagagtccaatgca
gactcccctggagcctcctccccagagcagcccaagagaaagaagggaagaaaaacaaaa
ccaccacgaccagattccccggccactacaccaaatatatctgtgaaaaagaaaagtaaa
gacgggaagggaaacacaatttacctttgggagtttttactggctctgcttcaggacaaa
gctacctgtcctaagtacatcaaatggacacagcgagaaaaaggcatttttaagttggtc
gactctaaagctgtgtccagattatgggggaagcacaaaaacaaacctgacatgaactat
gagaccatggggcgagcactcaggtactattaccaaagaggtattcttgcaaaagtggaa
ggtcagcgcttggtgtatcagtttaaagaaatgccaaaagaccttatctacatagacgat
gagggtccaagttccagcacagagtcttcagatcagtccttatcttcaacgaccacttct
agtcggaatcaagcaaaccgaacaagaatgtcttcaagtccaggaataaaaggaggggcc
actacaattctaaaaccagggaatcctaaagttgcaaaacccaaagacaccgtggaagtt
gggcagccttcagaagttttgaggacagtgcagccctcacaggctccctatcctacccag
ctcttccggactgtccatgtggtacagccagtacaagccatccccgaagaagcaaccata
accagcaccatgcaggaggaagctgcaggttcttcagttcagggcattaggacgatacag
gcttcaacccaggttccagtagtcgtgtctcctggcaaccaacagctacatacagtaaca
ctccagacagtgccactcacaacggttatagccagcacagacccgtcatcaggtgcaggg
ccgcagaaatttattttacaagccattccatcatcacagcccatgacagtactgaaagaa
aacgtcctgctacagtcacagaagccgggctctcctccttcaatcgtcttcagccctacc
ccagtacagcaggtccttacgggcagcgttcagtcccttggcaatggagctgtcagtatg
gcttcacctccaaacttcagtgctaccgcacctgtggtgactttctctcggagctcacag
ctggctgcacacccaccaggcaccgtgatcacgtctgttatcaaagctcaggaaacaaaa
actcctaaagcagaggtggagaaaaaggctgaaggtcatttgaatggagaccctgaggaa
attgaacagcagccccagccttatgtgatggtggtgtccagttcaaatgggttttcctct
caggtagccatcacacagaatgaactgctagagcccagctctttttaa

DBGET integrated database retrieval system