KEGG   Rattus norvegicus (rat): 85431Help
Entry
85431             CDS       T01003                                 

Gene name
Nox4
Definition
(RefSeq) NADPH oxidase 4
  KO
K21423  NADPH oxidase 4 [EC:1.6.3.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    85431 (Nox4)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.3  With oxygen as acceptor
    1.6.3.-  
     85431 (Nox4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_6 Ferric_reduct FAD_binding_8 NAD_binding_1
Motif
Other DBs
NCBI-GeneID: 85431
NCBI-ProteinID: NP_445976
RGD: 620600
Ensembl: ENSRNOG00000013925
UniProt: Q924V1
Position
1q32
AA seq 578 aa AA seqDB search
MALSWRSWLANEGVKHLCLLVWLSLNVLLFWKTFLLYNQGPEYYYIHQMLGLGLCLSRAS
ASVLNLNCSLILLPMCRTVLAYLRGSQKVPSRRTRRLLDKSKTLHITCGITICIFSGVHV
AAHLVNALNFSVNYSEHFLALNAARYQNEDPRKLLFTTVPGLTGVCMVVVLFLMVTASTY
AIRVSNYDIFWYTHNLFFVFYMLLLLHVSGGLLKYQTNLDTHPPGCISLNRTPSQNMSIA
DYVSEHFHGSLPGGFSKLEDHYQKTLVKICLEEPKFQAHFPQTWIWISGPLCLYCAERLY
RCIRSNKPVTIISVINHPSDVMELRMIKENFKARPGQYIILHCPSVSALENHPFTLTMCP
TETKATFGVHFKVVGDWTERFRDLLLPPSSQDSEILPFIQSRNYPKLYIDGPFGSPFEES
LNYEVSLCVAGGIGVTPFASILNTLLDDWKPYKLRRLYFIWVCRDIQSFQWFADLLYVLH
NKFWQENRPDFVNIQLYLSQTDGIQKIIGEKYHTLNSRLFIGRPRWKLLFDEIAKCNRGK
TVGVFCCGPSSISKTLHNLSNRNNSYGTKFEYNKESFS
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgtcctggaggagctggctggccaacgaaggggttaaacacctctgtctgctt
gtttggctgtccctaaatgtcctgcttttctggaaaaccttcctgctgtacaaccaaggg
ccagaatactactacatccaccagatgttgggcctaggattgtgtttgagcagagcttct
gcatctgtcctgaacctcaactgcagcctgatccttttacccatgtgccgcacagtcctg
gcttaccttcgcggatcacagaaggtccctagcaggagaacaagaagattgttggacaaa
agcaagactctacatatcacctgtggcataactatttgtattttctcaggtgtgcatgta
gctgcccacttggtgaacgccctgaacttctcagtgaactatagtgaacatttccttgca
ctgaatgcagcaagataccagaatgaggatcccagaaagcttctcttcacaactgttccg
ggcctgacaggtgtctgcatggtggtggtattgttcctcatggttacagcttctacctat
gcaataagagtttctaattatgatatcttctggtatactcacaacctcttctttgtcttc
tacatgctgctgctgctgcatgtttcgggtggcttgttgaagtatcaaaccaatttagac
actcaccctcctggctgtatcagtcttaaccggaccccatctcagaatatgtccatagca
gactacgtctcagaacattttcatggatctttgcctggagggttttcaaaattagaagat
cattaccagaaaacactggtgaagatttgcctggaagaacccaagttccaagctcatttc
ccacagacctggatttggatttctggacctttgtgcctatactgtgctgagagactttac
cgatgcatccggagcaacaaacctgtcaccattatctcagtaatcaatcatccctcagat
gtcatggaactccgtatgatcaaagaaaactttaaagcaagacctggccagtatattatt
ctacattgtcccagtgtatcagcattagaaaaccacccatttactctcacaatgtgtcct
actgaaaccaaagcaacatttggtgtccactttaaagtagtaggagactggacagaaaga
ttccgagatttactactgcctccatcaagccaagattctgagattctgcccttcattcaa
tctagaaactaccccaagttatacattgatggcccatttggaagtccatttgaggagtca
ctgaactatgaagttagtctgtgtgtggctggaggcattggggtcactccgtttgcatcg
atactaaacactctactggatgactggaaaccatacaagctaagaagactgtattttatc
tgggtctgcagagacatccaatcattccagtggtttgcagacttgctctatgtgctgcat
aacaagttttggcaagaaaacagacctgactttgtgaacatccagctgtacctcagtcaa
acagatgggatacagaagataattggagaaaaataccacacattgaattctagacttttt
attgggcgtcctcggtggaagcttttatttgatgaaatagcaaaatgtaacagagggaaa
acagttggagttttctgctgtggacccagttctatttccaagactcttcataatttgagt
aaccggaacaactcatatgggacaaaatttgaatacaataaagaatctttcagctaa

DBGET integrated database retrieval system