KEGG   Rattus norvegicus (rat): 85434
Entry
85434             CDS       T01003                                 

Gene name
Cdc5l
Definition
(RefSeq) cell division cycle 5-like
  KO
K12860  pre-mRNA-splicing factor CDC5/CEF1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    85434 (Cdc5l)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rno03041]
    85434 (Cdc5l)
   03400 DNA repair and recombination proteins [BR:rno03400]
    85434 (Cdc5l)
Spliceosome [BR:rno03041]
 Complex B
  Other components
   Prp19 complex
    85434 (Cdc5l)
 Complex C
   Prp19-CDC5 complex
    85434 (Cdc5l)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   PSO4 complex
    85434 (Cdc5l)
SSDB
Motif
Pfam: Myb_Cef Myb_DNA-binding Myb_DNA-bind_6 Rap1_C
Other DBs
NCBI-GeneID: 85434
NCBI-ProteinID: NP_445979
RGD: 70892
Ensembl: ENSRNOG00000019975
UniProt: O08837 B1WBQ0
Position
9q12
AA seq 802 aa
MPRIMIKGGVWRNTEDEILKAAVMKYGKNQWSRIASLLHRKSAKQCKARWYEWLDPSIKK
TEWSREEEEKLLHLAKLMPTQWRTIAPIIGRTAAQCLEHYEFLLDKTAQRDNEEETTDDP
RKLKPGEIDPNPETKPARPDPIDMDEDELEMLSEARARLANTQGKKAKRKAREKQLEEAR
RLAALQKRRELRAAGIEIQKKRKKKRGVDYNAEIPFEKKPALGFYDTSEENYQALDADFR
KLRQQDLDGELRSEKEGRDRKKDKQHLKRKKESDLPSAILQTSGVSEFTKKRSKLVLPAP
QISDAELQEVVKVGQASEVARQTAEESGITNSASSTLLSEYNVTNNSIALRTPRTPASQD
RILQEAQNLMALTNVDTPLKGGLNTPLHESDFSGVTPQRQVVQTPNTVLSTPFRTPSNGA
EGLTPRSGTTPKPVTNATPGRTPLRDKLNINPEDGMADYSDPSYVKQMERESREHLRLGL
LGLPAPKNDFEIVLPENAEKELEEREMDDTYIEDAADVDARKQAIRDAERVKEMKRMHKA
VQKDLPRPSEVNETILRPLNVEPPLTDLQKSEELIKKEMITMLHYDLLHHPYEPSGNKKG
KNVGFATNNSEHITYLEHSPYEKFSKEDLKKAQDVLVQEMEVVKQGMSHGELSSEAYNQV
WEECYSQVLYLPAQSRYTRANLASKKDRIESLEKRLEINRGHMTTEAKRAAKMEKKMKIL
LGGYQSRAMGLLKQLNDLWDQIEQAHLELRTFEELKKHEDSAIPRRLECLKEDVQRQQER
EKELQQRYADLLMEKETLQAKF
NT seq 2409 nt   +upstreamnt  +downstreamnt
atgccccggattatgatcaaagggggcgtgtggaggaatacggaggatgaaattcttaaa
gcagcggtaatgaaatatgggaaaaaccagtggtctaggattgcctcattgctgcatagg
aaatcggcaaagcagtgcaaagccagatggtacgaatggctggacccaagtattaagaaa
actgaatggtccagagaagaggaagaaaagctcttgcacttggccaagctgatgccaacg
cagtggaggaccattgctccaatcataggaaggacagcagcccagtgcttggagcactat
gaattcctcctggacaaaactgcccaaagggacaatgaagaggaaacaacagatgacccc
cgaaaacttaagcctggagagatagatccaaatccagaaaccaaaccagcccggcctgat
ccaattgacatggatgaggatgaacttgagatgctttctgaggctcgagcccgtttggcc
aatactcaaggaaagaaggctaagaggaaagcaagagaaaagcagttggaagaagcaagg
cgccttgctgccctccagaaaagacgggaacttcgagcagctggcatagagattcagaag
aaaaggaaaaagaagagaggagttgattataatgctgaaatcccatttgaaaaaaagcct
gctcttggtttttatgatacttctgaggagaattaccaggcccttgatgctgatttcagg
aaattacgacagcaggatcttgacggggagctaagatctgaaaaagaaggaagagataga
aaaaaagacaaacagcatttaaaaaggaaaaaagaatctgatttaccatctgctatcctt
caaactagtggtgtctctgagtttactaaaaagagaagcaaacttgtgctgcctgcccct
cagatttcagatgctgaactccaggaagttgtcaaggtaggccaggccagtgaagttgca
cggcagactgcggaggagtctgggatcacaaactctgcttctagcactctcctgtctgag
tacaatgtcacaaacaacagcattgctctgagaacaccacggactccagcctcccaagac
aggattctacaggaagctcagaacctcatggccttgaccaatgtggacactccactgaaa
ggtgggcttaacaccccactgcacgagagtgacttctctggtgtgacgccacagcggcag
gttgtgcagactccaaatacggttctgtctacccctttcaggactccttctaatggagct
gaagggctgactccccggagtggaacaaccccgaaaccagtcactaacgccaccccaggt
agaacaccacttagagacaaattaaacattaatccagaggatggaatggcagactacagt
gacccctcttacgtgaagcagatggaaagagaatctcgtgaacatctccgtctagggttg
ttaggcctccctgcaccgaagaatgattttgaaattgttctgccagaaaatgcggagaag
gaactggaagaacgtgaaatggatgacacgtacatcgaggatgctgctgatgtggatgct
cgaaagcaggccatacgagatgctgagcgtgtaaaggaaatgaaacgaatgcacaaagct
gttcagaaggatctacccagaccgtctgaagtaaatgaaactattttaagacctttaaat
gtagaaccacctctaacagatttgcagaaaagtgaggaactgatcaaaaaagagatgatt
acgatgcttcattatgacctgctgcatcacccctacgagccgtctgggaataagaaaggg
aaaaacgtcgggtttgctaccaacaattcagagcacattacctatcttgagcatagccct
tatgagaagttctccaaagaggatctaaaaaaggcccaggatgttctggtgcaagagatg
gaagtggtaaaacaaggaatgagccacggagaactctccagtgaagcttacaaccaggtg
tgggaggaatgctacagtcaagtcctctatcttcctgctcagagccgctacacacgggct
aatcttgctagcaaaaaggacagaattgaatcacttgaaaagagacttgagataaacagg
ggtcacatgacaacagaagccaagagagctgcaaagatggaaaaaaagatgaagattttg
ctgggtggttaccagtcccgcgccatggggctcctgaagcagctgaacgacctgtgggac
caaatcgagcaggcgcacctggagctgcgcacctttgaggaactcaagaaacacgaagac
tctgctattccccgtaggctagagtgtctaaaggaagatgtgcagcggcaacaggaaaga
gagaaagagcttcagcaaagatatgcggatttgctgatggagaaagagactttacaggca
aagttctga

DBGET integrated database retrieval system