KEGG   Rattus norvegicus (rat): 85471
Entry
85471             CDS       T01003                                 

Gene name
Gata3
Definition
(RefSeq) GATA binding protein 3
  KO
K17895  GATA-binding protein 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04928  Parathyroid hormone synthesis, secretion and action
rno05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    85471 (Gata3)
   04659 Th17 cell differentiation
    85471 (Gata3)
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    85471 (Gata3)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    85471 (Gata3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    85471 (Gata3)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys4 GATA-factors
    85471 (Gata3)
SSDB
Motif
Pfam: GATA TF_Zn_Ribbon ArfGap DZR_2 Prim_Zn_Ribbon
Other DBs
NCBI-GeneID: 85471
NCBI-ProteinID: NP_579827
RGD: 621250
Ensembl: ENSRNOG00000019336
UniProt: Q99NH5
Position
17q12.3
AA seq 444 aa
MEVTTDQPRWVSHHHPAVLNGQHPDTHHPGLGHSYMDPAQYPLTEEVDVLFNIDGQGNHV
PSYYGNSVRATVQRYPPTHHGSQVCRPPLLHGSLPWLDGGKALSSHHTASPWNLSPFSKT
SIHHGSPGPLSVYPPASSSSLAAGHSSPHLFTFPPTPPKDVSPDPSLSTPGSAGSARQDE
KECLKYQVQLPDSMKLETSHSRGSMTTLGGASSSAHHPITTYPPYVPEYSSGLFPPSSLL
GGSPTGFGCKSRPKARSSTEGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRP
LIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKE
GIQTRNRKMSSKSKKCKKVHDALEDFPKSSSFNPAALSRHMSSLSHISPFSHSSHMLTTP
TPMHPPSGLSFGPHHPSSMVTAMG
NT seq 1335 nt   +upstreamnt  +downstreamnt
atggaggtgactacggaccagccgcgctgggtgagccaccatcacccggcggtcctcaac
gggcagcacccagacacgcaccacccgggcctcggccattcgtacatggacccggcacag
taccccctgacggaagaggtggacgtactttttaacatcgatggtcaaggcaaccacgtc
ccgtcctactacggaaactcggtcagggctacggtgcagaggtatcctccgacccaccac
gggagccaggtatgccgcccgcctctgctgcacggatctctgccctggctggatggcggc
aaagccctgagcagccaccacaccgcctcgccctggaacctcagccccttctccaagacg
tccatccaccacggctccccggggcctctgtccgtctaccctccggcttcatcctcttct
ctggctgcgggccactccagtccgcatctcttcaccttcccgcccacccctccgaaggac
gtctccccagacccgtcgctgtccaccccgggatccgccgggtcggccaggcaagatgag
aaagagtgcctcaagtatcaggtgcagctgcccgatagcatgaagctggagacgtctcat
tcccgaggcagcatgaccaccctgggaggggcctcgtcttcagcccaccaccccattacc
acctatccgccctatgtgcccgagtacagctccggactcttccctcccagcagcctactg
ggaggatcccctaccgggttcggatgtaagtcgaggcccaaggcacgatccagcacagaa
ggcagggagtgtgtgaactgcggggcaacctctaccccactgtggcggcgagatggtact
gggcactacctttgcaacgcctgcggactctaccataaaatgaatgggcagaaccggccc
cttatcaagcccaagcgaaggctgtcagcagcgaggagagcagggacttcctgtgcgaac
tgtcagaccaccaccaccaccctctggaggaggaacgctaacggagaccccgtctgcaat
gcctgtgggctgtactacaaactccacaatattaacagacccctgactatgaagaaggag
ggcatccagacccgaaaccgtaagatgtctagcaaatcgaaaaagtgcaaaaaggtgcat
gatgcgctggaggacttccccaagagcagctccttcaacccggctgctctctccagacac
atgtcgtccctgagccacatctccccgttcagccactccagccacatgctgaccacaccg
acgcccatgcacccgccctccggcctctccttcggacctcaccatccatccagcatggtc
accgccatgggttag

DBGET integrated database retrieval system