KEGG   Rattus norvegicus (rat): 85482Help
Entry
85482             CDS       T01003                                 

Gene name
Nbn, Nbs1
Definition
(RefSeq) nibrin
  KO
K10867  nibrin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03440  Homologous recombination
rno04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    85482 (Nbn)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    85482 (Nbn)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rno03032]
    85482 (Nbn)
   03400 DNA repair and recombination proteins [BR:rno03400]
    85482 (Nbn)
DNA replication proteins [BR:rno03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    MRN complex
     85482 (Nbn)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    MRN(MRX) complex
     85482 (Nbn)
    BRCA1-C complex
     85482 (Nbn)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nbs1_C NIBRIN_BRCT_II FHA RTT107_BRCT_5 Yop-YscD_cpl BRCT
Motif
Other DBs
NCBI-GeneID: 85482
NCBI-ProteinID: NP_620228
RGD: 621420
Ensembl: ENSRNOG00000008580
UniProt: Q9JIL9
Position
5q13
AA seq 750 aa AA seqDB search
MWKLLPAASAAPGEPCRLLAGVEYIVGRKNCAILIENDQSISRNHAVLRVNFPVTSLSQT
DEIPTLIIKDNSKYGTFINEEKMQNGLSSTLKTGDRVTFGVFESKFRVEYEPLVVCSSCL
DVSGKTVLNQAILQLGGLTANSWTEECTHLAMSSVKVTIKTICALICGRPIVKPEYFSEF
LKAVESKTQPPEIESFYPPIDEPAIGNKSVDLSGRRERKQIFKGKTFVFLNAKQHKKLGS
AVVFGGGEARLMAEGGEEEQSFFSAPGTCVVDVGITNTQLIITDSQRKWIHLIMDILQRH
DLRPIPEAEIGLAVIFMTTESYCNPQGQPCTEVKTTTPGPSLSQGLSANGKVIPSAPMNM
TTYVADTESEPADTCMSLSERPEEVKIFGLDQNSRKLLQGTCNIKETSNQSSNSNNAASN
TLVRGKAPNYQLSPMKCPAASKNKDWSSQQQLNSIKNYFQPCSRKRERDEENPEQSSCKS
SRVELSCSLLEQTQPAEPSLWKSKDHESQSETLGRASNASSVGGIDIKPNGKSPDSKSFS
TEDLRARKRKEVDLSTEEEVLEELLRSTKPELAVQVKVEKQEADVSIRKKPRMDAERNQH
LNGGPVPESNSALQEDETEKKDELQIEAWSTKREVSNTDELQDSSEELPRKLLLTEFRSL
VVHNNSSRNLCPLNGRGELKNFKKFKKATCPGAGKLPHIIGGSDLIGHHARKNTELEEWL
KHEMEVQKQQAKEDSLADDLFRYNPNVKRR
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atgtggaagctgctcccggccgcaagtgcggctccaggagaaccatgtcgacttttggct
ggcgtagagtacattgttgggaggaaaaactgtgccattctaatcgaaaatgatcagtca
atcagtcgaaatcatgctgtattaagagtaaactttcctgtaaccagtttgagtcaaacg
gatgaaattcctacattaataataaaagataattctaagtatggaacctttattaacgaa
gaaaaaatgcagaatggcctttcttccactttgaagacaggagatagagttacctttggg
gtgtttgaaagtaaattcagagtagaatacgagcctttggttgtttgctcttcttgttta
gatgtctctgggaaaactgttttaaaccaagctatattacagcttggaggactcactgca
aacagctggacagaagagtgtactcaccttgccatgtcatcagtcaaagtcaccattaaa
actatatgtgcactcatttgtggacgtccaattgtaaagccagaatacttttctgaattt
ctcaaagcagttgagtccaagacacaacctccagaaattgaaagtttttacccacccatc
gatgaaccagctattggaaataaaagtgtcgatctgtccggacgacgtgaaagaaaacaa
atcttcaaaggaaaaacattcgtgtttttaaatgccaagcagcataagaaactcggctcg
gcagttgttttcggaggtggggaagccaggctgatggcagaaggaggtgaagaggaacag
agcttcttctcagctcccggaacctgtgttgttgacgtaggaataacaaacacacagctc
ataattacggactcccagaggaagtggattcatttgataatggatatacttcaaaggcat
gatctcagacctattcctgaagcagagattggattggctgttatttttatgactacagag
agttactgtaatccgcagggccagccttgtacagaggtaaagacgacgactccaggacca
agcctttcccagggcctgtcagccaatggaaaagtcatccccagtgcgccaatgaatatg
accacatacgtagctgacacagaatcagagccagcagatacatgtatgtctctgagtgaa
agaccagaagaagtaaagatctttggactcgatcaaaactctagaaagcttttacaagga
acatgcaatataaaggagacctctaatcaaagctccaattctaacaatgcagcatcaaat
acactggttaggggaaaggccccgaactatcagctttcaccaatgaaatgtcctgctgca
agtaaaaataaagattggtcttctcagcagcagctgaactccatcaaaaactacttccag
ccatgctccagaaaaagggaaagggatgaagaaaatccagaacagtcctcatgcaaatcg
tcaagagtggaactgtcttgttctcttttagaacaaacgcaacctgcagaaccctcactg
tggaaaagcaaagaccatgagtctcagagtgagactctgggcagggcatccaatgcctca
tctgtgggtggaatagacataaaacccaatgggaagagtcctgacagtaagtcattttcc
acagaagatcttagagcaagaaaaagaaaagaagtggatttgtctacagaagaggaagtg
ttggaagagttactcaggagcacaaagccagagctggcagttcaagtgaaggttgaaaag
caggaggcagatgtcagcatcagaaagaagcccaggatggatgcagagaggaatcagcac
ctgaacggtggcccagtgccagaaagcaacagcgcacttcaagaagatgaaacagaaaag
aaagatgagcttcagatagaagcatggtcaacaaaacgtgaagtatctaatactgatgag
cttcaggacagcagtgaggaacttccaagaaaactgctgctgactgaatttaggtcactg
gttgtccataataactcttccagaaatctgtgcccactaaatggtcgtggtgaactgaag
aatttcaagaaattcaagaaggctacgtgtcctggagcaggaaagcttccacacattatt
ggaggatcagatttaataggtcaccatgctcgaaagaatactgaattagaagagtggttg
aaacatgaaatggaggtacagaaacaacaagcgaaagaagactctcttgctgatgatctg
tttagatataatcctaatgtaaaaagaagataa

DBGET integrated database retrieval system