KEGG   Rattus norvegicus (rat): 85492
Entry
85492             CDS       T01003                                 
Symbol
Psmb7
Name
(RefSeq) proteasome subunit beta type-7
  KO
K02739  20S proteasome subunit beta 2 [EC:3.4.25.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03050  Proteasome
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    85492 (Psmb7)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    85492 (Psmb7)
   05012 Parkinson disease
    85492 (Psmb7)
   05014 Amyotrophic lateral sclerosis
    85492 (Psmb7)
   05016 Huntington disease
    85492 (Psmb7)
   05017 Spinocerebellar ataxia
    85492 (Psmb7)
   05020 Prion disease
    85492 (Psmb7)
   05022 Pathways of neurodegeneration - multiple diseases
    85492 (Psmb7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    85492 (Psmb7)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:rno03051]
    85492 (Psmb7)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     85492 (Psmb7)
Peptidases and inhibitors [BR:rno01002]
 Threonine peptidases
  Family T1: proteasome family
   85492 (Psmb7)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    85492 (Psmb7)
SSDB
Motif
Pfam: Proteasome Pr_beta_C
Other DBs
NCBI-GeneID: 85492
NCBI-ProteinID: NP_445984
RGD: 621093
Ensembl: ENSRNOG00000011732
UniProt: Q9JHW0
Structure
Position
3:complement(22357777..22417748)
AA seq 277 aa
MAAVSVFQAPVGGFSFDNCRRNAVLEADFAKKGFKLPKARKTGTTIAGVVYKDGIVLGAD
TRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLTTGRLPRVV
TANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAV
FEDKFRPDMEEEEAKKLVSEAIAAGIFNDLGSGSNIDLCVISKSKLDFLRPYSVPNKKGT
RFGRYRCEKGTTAVLTEKVTPLELEVLEEIVQTMDTS
NT seq 834 nt   +upstreamnt  +downstreamnt
atggcggctgtgtcggtgtttcaggcaccggtcggaggcttttcttttgataattgccgc
aggaatgcggtcttggaagctgattttgcaaaaaaggggttcaaacttccgaaagctcgg
aaaactggcactaccatcgcgggggtggtctataaggatggaatagttcttggagcagac
acgagagcaactgaagggatggttgttgctgacaaaaactgttcaaaaattcacttcata
tctcctaatatttattgctgtggtgctgggacagctgcagacacagacatgacaacccag
cttatttcttctaacttggagctccactctctcaccaccggccgccttcccagagttgtc
acagcgaatcggatgctgaagcagatgcttttcaggtatcaaggttacattggtgcagcc
ctagttttggggggagtcgatgttactggacctcatctctacagcatctatccgcatgga
tcaactgataaactgccttatgtcaccatgggttctggctccttggcagcaatggctgtg
tttgaagataagtttaggccagatatggaggaggaagaagccaagaagctagtgagtgaa
gctattgcagctggcatctttaatgacttggggtctggaagcaacattgatctgtgtgtt
atcagcaagagcaagctggactttctccgtccatactcagtgcccaacaagaaagggacc
aggtttggccggtacaggtgtgagaaaggcactaccgctgtcctcacggagaaagtcacc
cctctggagctcgaggtgctagaagagattgttcagacaatggacacttcgtga

DBGET integrated database retrieval system