KEGG   Rattus norvegicus (rat): 85494Help
Entry
85494             CDS       T01003                                 

Gene name
Tpra1, Gpr175, Tpra40
Definition
(RefSeq) transmembrane protein adipocyte associated 1
  KO
K22988  transmembrane protein adipocyte-associated 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    85494 (Tpra1)
G protein-coupled receptors [BR:rno04030]
 Others
  Others
   Orphan GPCRs
    85494 (Tpra1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tmemb_40
Motif
Other DBs
NCBI-GeneID: 85494
NCBI-ProteinID: NP_445986
RGD: 620858
Ensembl: ENSRNOG00000016665
UniProt: G3V859
Position
4q34
AA seq 369 aa AA seqDB search
MANLQEANGSTAWPPPPASNISEPHQCLLLLYEDIGSSRVRYWDLLLLIPNVLFFIFLLW
KLPLARAKIRVTSSPIFITFYILVFVVALVGIARAVVSMTVSASDAATVADKILWEITRF
FLLAIELSVVILGLAFGHLESKSSIKRVLAITTVLSLAYSVTQGTLEILYPDSHLSAEDF
NIYGHGGRQFWLVSSCFFFLVYSLVVILPKTPLKDRVSLPSRRSFYVYAGILATLNLLQG
LGSALLCADITEGLCCVDATTFLYFSFFAPLIYVAFLRGFFGSEPKILFSYKCQVDEAEE
PDMHLPQPYAVARREGIESAGPSGVSAANYSSTQFDSAGVAYLDDIASMPCHTGSINSTD
SERWKAINA
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggccaacctgcaggaggccaatggaagcacagcgtggccaccgcccccagcatccaat
atcagtgagccccaccaatgcctgctgctgctgtatgaggatatcggctcctccagggtc
cggtactgggacctcctgctgctcattcccaatgtgctcttcttcatcttcctgctctgg
aagcttcccttagctcgggccaagatccgtgtcacctccagccccatttttattaccttc
tacatcttggtgtttgtggtagccctggttggcattgccagggctgtggtttctatgaca
gtcagtgcctctgatgctgcgacagttgctgataagatcctgtgggagatcacccgcttc
ttcctgctggccattgagctgagtgtggtcatcctgggccttgcctttggtcacctagag
agcaagtccagcatcaagcgggtactggctatcaccacagtactgtctctggcctactca
gtcacccaggggactctggagatcctgtaccctgactcccatctgtcagctgaggatttc
aacatctatggccatggtggccgccagttctggcttgtcagctcttgcttctttttcctg
gtctactcactggtggtaattctccccaagaccccgctgaaggatcgtgtatccctgccc
tcacggaggagtttctacgtgtatgcaggcatcctggccacacttaacttactgcagggt
ttggggagtgctctgctctgcgctgacatcactgaggggctctgctgtgtggacgccacc
accttcctgtacttcagcttctttgcgcccctcatctatgtggccttcctccgtggcttc
ttcggctcagagcccaagatccttttctcttacaaatgccaagtggatgaggcagaggag
ccagacatgcacctgccacaaccctacgccgtggcccggcgcgagggcatcgagtccgca
ggaccctcgggagtctcagcagccaactactccagcacgcagttcgactctgctggggtg
gcctacttagatgacattgcctccatgccctgccacacgggcagcatcaacagcacagac
agtgagcgttggaaagctatcaatgcctga

DBGET integrated database retrieval system