KEGG   Rattus norvegicus (rat): 89776Help
Entry
89776             CDS       T01003                                 

Gene name
Slc22a7, Oat2
Definition
(RefSeq) solute carrier family 22 member 7
  KO
K08204  MFS transporter, OCT family, solute carrier family 22 (organic anion transporter), member 7
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    89776 (Slc22a7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    89776 (Slc22a7)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC22: Organic cation/anion/zwitterion transporter
   89776 (Slc22a7)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Organic cation transporter (OCT) family [TC:2.A.1.19]
    89776 (Slc22a7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sugar_tr MFS_1 MFS_2 TRI12
Motif
Other DBs
NCBI-GeneID: 89776
NCBI-ProteinID: NP_445989
RGD: 621699
Ensembl: ENSRNOG00000018420
UniProt: Q5RLM2
Position
9q12
AA seq 535 aa AA seqDB search
MGFEDLLDKVGGFGPFQLRNLVLMALPRMLLPMHFLLPVFMAAVPAHHCALPGAPANLSH
QDLWLEAHLPRETDGSFSSCLRFAYPQTVPNVTLGTEVSNSGEPEGEPLTVPCSQGWEYD
RSEFSSTIATEWDLVCQQRGLNKITSTCFFIGVLVGAVVYGYLSDRFGRRRLLLVAYVSS
LVLGLMSAASINYIMFVVTRTLTGSALAGFTIIVLPLELEWLDVEHRTVAGVISTVFWSG
GVLLLALVGYLIRSWRWLLLAATLPCVPGIISIWWVPESARWLLTQGRVEEAKKYLLSCA
KLNGRPVGEGSLSQEALNNVVTMERALQRPSYLDLFRTSQLRHISLCCMMVWFGVNFSYY
GLTLDVSGLGLNVYQTQLLFGAVELPSKIMVYFLVRRLGRRLTEAGMLLGAALTFGTSLL
VSLETKSWITALVVVGKAFSEAAFTTAYLFTSELYPTVLRQTGLGLTALMGRLGASLAPL
AALLDGVWLLLPKVAYGGIALVAACTALLLPETKKAQLPETIQDVERKSTQEEDV
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgggcttcgaagacctgctggacaaggtgggcggctttgggcccttccaacttcggaat
ctggttctgatggccctgccccgaatgctgctccccatgcactttctcctgcccgtcttc
atggccgctgtgcctgcccaccattgtgccctgcccggtgcccctgccaacctcagtcac
caggacttatggctggaagcccatctaccccgggagactgacggcagctttagctcctgc
ctccgatttgcctatccccagactgtccccaatgtcactttggggacagaggtgtccaac
tctggggagcctgagggtgagcccctcacggtgccctgctctcagggctgggagtacgac
cgctcagaattctcctccaccattgcaactgagtgggatcttgtgtgtcagcagagagga
ctgaacaaaattacgtccacctgcttcttcattggtgtgctggtgggagccgtggtgtat
ggatacttgtctgacaggtttggcaggcgccggcttctgctggtggcctacgtgagctcc
ctggtgctgggtctgatgtctgcagcctccatcaactacatcatgttcgtagtcacccgt
acactcaccggctcagccctggctggcttcaccatcattgtgctcccactggagttggag
tggctggatgtggagcaccgcactgtggccggggtcatcagcaccgtcttctggtcggga
ggcgtgctgctgctggcactggtgggctacctgatccggagctggcgctggcttctgctg
gctgccaccctgccgtgtgtcccaggcatcatcagcatctggtgggttcctgagtctgca
cggtggcttctaacccagggtcgtgtggaggaggcaaaaaaatacttgctgagctgtgcc
aagctcaatgggcggcccgtgggtgagggcagcctgagccaggaggccctgaacaacgtg
gtcaccatggaaagggcgttgcaaagaccctcatacttagacctgttccgaacatctcag
ctccgacatatctcactgtgctgcatgatggtgtggtttggagtgaacttttcctactac
ggcctgactctggacgtgtctgggctggggctgaacgtgtaccagacacagctgctgttt
ggggctgtggagctcccctccaaaattatggtctacttccttgtgcgccgtctgggacgc
cgtctcacggaggctgggatgctgctgggcgctgctctgacctttggcaccagcctgctg
gtatccttggagactaagtcatggatcactgctctggtggtggtggggaaagctttttct
gaagctgcttttactacggcctacctgttcacgtccgagttgtaccctactgtgctcaga
cagacaggattgggacttactgcactcatgggcaggctaggggcctctctggccccactg
gcggccttgctggatggagtgtggctgttgctgcccaaagttgcttacggggggattgcc
ctggtggctgcctgcactgcactcctgctgcctgagacgaagaaggcacagctgccagag
accatccaggatgtggagaggaagagtacccaggaggaagatgtgtag

DBGET integrated database retrieval system