KEGG   Rattus norvegicus (rat): 89803Help
Entry
89803             CDS       T01003                                 

Gene name
Sfrp4
Definition
(RefSeq) secreted frizzled-related protein 4
  KO
K02185  secreted frizzled-related protein 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    89803 (Sfrp4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fz NTR
Motif
Other DBs
NCBI-GeneID: 89803
NCBI-ProteinID: NP_445996
RGD: 621075
Ensembl: ENSRNOG00000054957
UniProt: Q9JLS4
Position
17q11
AA seq 348 aa AA seqDB search
MLLSILVALCLCVRLALGVRGAPCEAVRIPMCRHMPWNITRMPNHLHHSTQENAILAIEQ
YEELVDVNCSSVLRFFLCAMYAPICTLEFLHDPIKPCKSVCQRARDDCEPLMKMYNHSWP
ESLACDELPVYDRGVCISPEAIVTDLPEDVKWIDITPDMMVQERSFDADCKHLSPDRCKC
KKVKPTLATYLSKNYSYVIHAKIKAVQRSGCNEVTTVVDVKEIFKSSSPIPRTQVPLITN
SSCQCPHILPXQDVLIMCYERRSRMMLLENCLVEKWRDQLSRRSTQWEERLQEQQRTTQD
KKQIASRTSRSNPPKPKGRSPASKPASPKKNIKARSAPKKSNPKKSTS
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgctcctctccatcctggtagcgttatgcctgtgcgtgcgcctggctctgggagtgcgc
ggagcgccctgcgaggctgtgcgcatccccatgtgtaggcacatgccctggaacatcacc
cggatgcccaaccacctgcaccacagcactcaggagaacgccatcctggccatcgagcag
tacgaggagctggtagacgtgaactgcagctctgtactgcgcttctttctctgtgccatg
tatgcacccatctgtaccctggagttcctgcacgatcccatcaaaccctgcaaatctgtg
tgccagcgcgcacgcgacgactgcgagcccctcatgaagatgtataaccacagctggcca
gagagcctggcttgcgatgagctgcctgtctatgaccgtggagtgtgcatctctccggag
gcgatagtcactgaccttccggaagatgtgaagtggatagacatcacaccagatatgatg
gttcaagaaaggtcctttgatgctgactgtaaacatctgagccctgatcggtgcaagtgc
aaaaaggtgaagccaactttggcaacgtacctgagcaaaaactacagctatgttattcat
gccaaaataaaagcggtccagaggagtggttgcaatgaggtcacaactgtggtcgatgta
aaagagatcttcaagtcttcatcacctatccctcgaacgcaagtccccctcatcaccaat
tcctcctgccagtgtccacacatcctgccccntcaagatgtcctaatcatgtgttatgag
cggcgttcaaggatgatgcttcttgaaaattgtttagttgagaaatggagagatcaacta
agcagaaggtccacacagtgggaagagaggcttcaggaacagcagagaacaactcaggac
aagaagcaaatagccagccgcaccagtcgcagtaaccccccaaagccaaagggaaggtca
cctgcttccaaacctgccagtcctaagaagaacatcaaagctagaagtgcacccaaaaag
tcaaacccaaagaaaagtacaagctaa

DBGET integrated database retrieval system