KEGG   Rattus norvegicus (rat): 89804Help
Entry
89804             CDS       T01003                                 

Gene name
Tek, Tie-2, Tie2
Definition
(RefSeq) TEK receptor tyrosine kinase
  KO
K05121  endothelial-specific receptor tyrosine kinase [EC:2.7.10.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04066  HIF-1 signaling pathway
rno04151  PI3K-Akt signaling pathway
rno05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    89804 (Tek)
   04015 Rap1 signaling pathway
    89804 (Tek)
   04010 MAPK signaling pathway
    89804 (Tek)
   04066 HIF-1 signaling pathway
    89804 (Tek)
   04151 PI3K-Akt signaling pathway
    89804 (Tek)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    89804 (Tek)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    89804 (Tek)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    89804 (Tek)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     89804 (Tek)
Protein kinases [BR:rno01001]
 Receptor tyrosine kinases (RTK)
  TIE family
   89804 (Tek)
CD molecules [BR:rno04090]
 Proteins
  89804 (Tek)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Ig_Tie2_1 fn3 Pur_ac_phosph_N EGF_2 DUF2369 hEGF APH Haspin_kinase DUF4702
Motif
Other DBs
NCBI-GeneID: 89804
NCBI-ProteinID: NP_001099207
RGD: 620980
Ensembl: ENSRNOG00000008587
UniProt: D3ZCD0
Position
5q33
AA seq 1120 aa AA seqDB search
MDSLAGLVLCGVSLLLYGLVEGAMDLILINSLPLVSDAETSLTCIASGWHPHEPITIGRD
FEALMNQHQDPLEVTQDVTREWAKKVVWKREKASKINGAYFCEGRVRGQAIRIRTMKMRQ
QASFLPATLTMTVDRGDNVNISFKKVLIKEEDAVIYKNGSFIHSVPRHEVPDILEVHLPH
AQPQDAGVYSARYIGGNLFTSAFTRLIVRRCEAQKWGPDCNRPCTTCKNNGVCHEDTGEC
ICPPGFMGRTCEKACEPHTFGRTCKERCSGSEGCKSYVFCLPDPYGCSCATGWRGLQCNE
ACPYGHYGPDCKLRCHCTNEEMCDRFQGCLCSQGWQGLQCEKEGRPRMTPQIEDLPDHIE
VNSGKFNPICKASGWPLPTSEEMTLVKPDGTVLQPNDFNHTDHFSVAIFTVNRILPPDSG
VWVCSVNTVAGMVEKPFNISVKVLPEPLHAPNVIDTGHNFAIINISSEPYFGDGPIKSKK
LFYKPVNQAWKYIQVMNEIVTLNYLEPRTDYELCVQLVRPGEGGEGHPGPVRRFTTASIG
LPPPRGLSLLPKSQTALNLTWQPIFTSSEDEFYVEVERWSQQTRSDQQNIKVPGNLTSVL
LNNLLPREQYSVRARVNTKAQGEWSEELRAWTLSDILPPQPENIKITNITDYTALVSWTI
VDGYSISSIIIRYKVQGKNEDQHIDVKIKNATITQYQLKGLEPETTYHVDIFAENNIGSS
NPAFSQEIRTLPAPKDLGGGKMLLIAILGSAGMTCITVLLAFLIMLQLKRANVQRRMAQA
FQNVREEPAVQFNSGTLALNRKAKNNPDPTIYPVLDWNDIKFQDVIGEGNFGQVLKARIK
KDGLRMDAAIKRMKEYASKDDHRDFAGELEVLCKLGHHPNIINLLGACEHRGYLYLAIEY
APHGNLLDFLRKSRVLETDPAFAIANSTASTLSSQQLLHFAADVARGMDYLSQKQFIHRD
LAARNILVGENYIAKIADFGLSRGQEVYVKKTMGRLPVRWMAIESLNYSVYTTNSDVWSY
GVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRLEKPLNCDDEVYDLMRQCWREKPYERPS
FAQILVSLNRMLEERKTYVNTTLYEKFTYAGIDCSAEEAA
NT seq 3363 nt NT seq  +upstreamnt  +downstreamnt
atggactctttagccggcttagttctctgtggagtcagcttgctcctttatggactagta
gaaggagccatggacctgatcttgatcaattccctacctcttgtgtctgatgccgaaaca
tccctcacctgcattgcttctgggtggcacccccacgagcccatcaccataggaagggac
tttgaagccttaatgaaccagcaccaagatccactggaagttactcaagatgtgaccaga
gaatgggcgaaaaaggttgtttggaagagagaaaaggccagtaagattaatggtgcttat
ttctgtgaaggtcgagttcgaggacaggctataaggatacgaaccatgaagatgcgtcaa
caagcttcctttctacctgctactctaactatgaccgtggacaggggagataatgtgaac
atatccttcaaaaaggtgttaattaaagaagaagatgcagtgatttacaaaaatggttcc
ttcattcattcagtgccccggcatgaagttcctgatattttagaagtgcatctgcctcac
gctcagccccaggatgctggtgtgtactcggccaggtacataggaggaaacctgttcacc
tcggccttcaccaggctgattgtccggagatgtgaagctcagaagtggggacccgactgt
aaccgtccttgtactacttgcaagaacaatggtgtctgccatgaagatactggggagtgc
atttgccctcctgggtttatggggaggacatgtgaaaaggcttgtgagccacacacattt
ggcaggacctgtaaggaacggtgtagtggatcagagggatgcaagtcatatgtgttctgt
ctgccagacccctatgggtgttcctgtgccacaggctggagggggctgcagtgcaatgaa
gcatgtccatacggtcactatgggccagactgtaagctcaggtgccactgtaccaatgaa
gagatgtgtgaccgcttccaaggatgcctctgctctcaaggatggcaagggctgcagtgt
gagaaagaaggcaggccaaggatgactccacagatagaggatttgccagatcacatagaa
gtaaacagtgggaaatttaacccgatctgcaaggcctctggctggccactacctactagt
gaagaaatgaccctggtgaagccggatgggacagtgctccaaccaaatgacttcaaccat
acagatcatttctcagtggccatattcactgtcaaccggatcttacctcctgactcagga
gtttgggtctgcagtgtgaacacagtggctgggatggtggaaaagcctttcaacatttct
gtcaaagttcttccagagcccctgcatgccccaaatgttattgacactggacacaacttt
gctatcatcaacatcagctctgagccttactttggggatggaccgatcaaatccaagaag
ctcttctataaacctgtcaatcaggcttggaaatacattcaagtgatgaatgagattgtc
acactcaactacctggagcctcggactgactacgagctgtgtgtacagctggtccgtcct
ggagagggtggagaaggacatcctggacctgtgagaagattcacaacagcgtctatcgga
ctccctcctccaagaggtctcagtctcctacccaaaagccagacagctctgaatttgact
tggcaaccgatatttacaagctcagaagatgaattttatgtggaagttgagaggtggtcc
cagcaaacaagaagtgatcagcagaacatcaaagtgcctgggaacctgacttccgtgctg
ctgaacaacttactccccagggagcagtacagcgtccgagctagagtcaacaccaaggcc
cagggggagtggagtgaagaactcagggcctggacccttagtgacattctccctcctcag
ccagaaaacatcaagatcaccaacatcactgattacacagctctggtttcttggacaatc
gtggacggctattcgatttcttccatcatcatccggtataaggttcagggcaaaaatgaa
gaccagcacattgacgtgaagatcaagaatgccaccatcactcaataccagctcaagggc
ctagagccagagactacataccatgtggatatttttgctgagaacaacataggatcaagc
aacccagccttttcccaagaaattaggacacttccagcccctaaagaccttggaggggga
aagatgctacttatagccattcttgggtcggctggaatgacttgcatcaccgtgctattg
gcgtttctgattatgttgcaactgaagagagcaaatgtccaaagaagaatggcccaggcc
ttccagaacgtgagagaagaaccagctgttcagttcaactcaggaactctggccctaaac
aggaaggccaaaaacaatccggatcccacaatttatcctgtgcttgactggaatgacatc
aagttccaagatgtgattggagagggcaactttggccaggttctgaaggcgcgcatcaag
aaggatgggttacggatggacgctgccatcaagaggatgaaagaatatgcctccaaagat
gatcacagggactttgcaggagaactggaggttctttgtaaacttggacaccatccgaac
atcattaatctcttgggagcatgtgaacacagaggctacttatacctggctattgagtat
gccccacatggaaacctcctggactttctgcgtaagagccgagtgctagagacagaccct
gcctttgccatcgccaacagcacggcttccacactgtcctcccagcagcttcttcatttt
gctgcagatgtggcccgggggatggactacttgagccaaaaacagtttatccacagggac
ctggctgccagaaacattttagttggcgaaaactacatagccaaaatagcagattttgga
ttgtcacgaggtcaagaagtgtatgtgaaaaagacaatgggaaggctcccagtgcgctgg
atggcaattgagtctctgaactatagtgtctatacaaccaacagtgatgtatggtcctat
ggtgtattgctctgggagatcgttagcttaggaggcactccatactgcggcatgacatgt
gcagaactctatgagaagctgccccagggctacagattggagaagcccctgaactgtgat
gatgaggtgtatgatctaatgagacaatgctggagggagaagccttatgagagaccatca
tttgcccagatattggtgtccttaaacagaatgctggaagaacgaaagacatacgtgaac
accacactttatgagaagtttacctacgcaggaattgactgttctgctgaagaagcagcc
tag

DBGET integrated database retrieval system