KEGG   Rattus norvegicus (rat): 89806Help
Entry
89806             CDS       T01003                                 

Gene name
Tie1
Definition
(RefSeq) tyrosine kinase with immunoglobulin-like and EGF-like domains 1
  KO
K05120  tyrosine kinase receptor 1 [EC:2.7.10.1]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    89806 (Tie1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     89806 (Tie1)
Protein kinases [BR:rno01001]
 Receptor tyrosine kinases (RTK)
  TIE family
   89806 (Tie1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase fn3 ig I-set Pur_ac_phosph_N Ig_3 Ig_2 EGF_2 hEGF TadZ_N Pkinase_fungal C2-set Haspin_kinase DUF4702 EGF
Motif
Other DBs
NCBI-GeneID: 89806
NCBI-ProteinID: NP_445997
RGD: 621642
Ensembl: ENSRNOG00000020173
Vega: OTTRNOG00000002345
UniProt: B5DFD6
Position
5q36
AA seq 1137 aa AA seqDB search
MVWWGSPFLLPILFLASHVGASVDLTLLANLRITEPQRFFLTCVSGEAGAGRSSDVWGPP
LLLEKDDRIVRTFPPGQPLHLTRNGSHQVTLRGFSKPSDLVGVFSCVGGAGTRRTRVLYV
HNSPGAHLFPDKVTHTVNKGDTAVLSARVHKEKQTDVIWKNNGSYFHTLDWHEAHDGRFQ
LQLQNVQPPSSGIYSATYLEASPLGSAFFRLIVRGCEAGRWGPGCVKDCPGCLHGGVCHD
HDGECVCPPGFTGTRCEQACREGRFGQSCQEQCPGTAGCRGLTFCLPDPYGCSCGSGWRG
SQCQEACAPGHFGADCRLQCQCQNGGTCDRFSGCVCPSGWHGVHCEKSDRIPQILNVATE
LEFNLGTMPRINCAAAGNPFPVRGSMELRKPDGTMLLSTKAIVEPDRTTAEFEVPRLTLG
DSGFWECRVSTSGGQDSRRFKVNVKVPPVPLTAPRLLAKQSRQLVVSPLVSFGGDGPISS
VRLHYRPQDSMITWSAIVVDPSENVTLMNLKPRTGYNVRVQLSRPGEGGEGAWGPSTLMT
TDCPEPLLQPWVESWNVEGPDRLRVSWSLPSVPLSGDGFLLRLWDGARGQERRENISSPQ
ARTALLTGLTPGTHYQLDVRLYHCTLLGPASPSAHVHLPLSGPPAPRHLRAQALSDSEIR
LMWQHPEAPPGPISKYIVEIQVAGGSGDPQWMDVDKPEETSTTVRGLNASTRYLFRVRAS
VQGLGDWSNTVEETTLGNGLQSASPVQESRVAEDGLDQQLVLAVVGSVSATCLTILAALL
ALVCIRRSCLHRRHTFTYQSGSGEETILQFSSGTLTLTRRPKPQPEPLSYPVLEWEDITF
EDLIGEGNFGQVIRAMIKKDGLKMNAAIKMLKEYASENDHRDFAGELEVLCKLGHHPNII
NLLGACENRGYLYIAIEYAPYGNLLDFLRKSRVLETDPAFAREHGTASTLSSRQLLRFAS
DAANGMQYLSEKQFIHRDLAARNVLVGENLASKIADFGLSRGEEVYVKKTMGRLPVRWMA
IESLNYSVYTTKSDVWSFGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRMEQPRNCDDE
VYELMRQCWRDRPYERPPFAQIALQLGRMLEARKAYVNMSLFENFTYAGIDATAEEA
NT seq 3414 nt NT seq  +upstreamnt  +downstreamnt
atggtctggtggggatcccctttcctgctccccattctttttctggcctctcatgttggt
gcatccgtggatttaacactgctggccaatctgcgtatcaccgaaccccagcgtttcttc
ctgacctgtgtgtctggtgaggcgggagcagggaggagctccgacgtctggggcccgccc
ctgctgctggaaaaggatgatcgcatagtgcgcaccttcccacccgggcagcccctgcac
ctcactcgcaacggttcacaccaggtcacgctgcggggcttctccaagccctcggattta
gtaggcgtcttctcctgcgtgggtggagctggcacgaggcgcactcgagtcctctatgtg
cacaacagcccgggggcacacctgtttccagacaaggtcacacacacggtgaacaaaggt
gataccgctgtgctttctgcacgagtgcacaaggaaaagcagactgatgtgatttggaag
aacaatggatcctacttccataccctagactggcatgaggcccatgatgggcggtttcaa
ctgcagctccaaaatgtacagccaccatcgagtggcatctacagcgccacctacctagag
gccagccccttgggcagtgccttctttcggctcatcgtgcgaggctgtgaggctggacgc
tgggggccgggatgtgtcaaggattgcccaggctgcctgcatggaggtgtctgtcatgac
cacgatggcgaatgtgtgtgcccccctggattcactggcacccgctgtgagcaggcctgc
agagaaggtcgttttggacagagctgccaggaacagtgcccaggcacagcaggctgtcgg
ggtctcaccttctgcctcccagatccctatggctgttcttgtggatctggctggagggga
agccagtgccaggaagcatgtgcacctggtcattttggggcagattgtcgcctccagtgt
cagtgtcaaaatggtggtacttgtgatcggttcagcggctgcgtctgcccctccgggtgg
catggagtccactgtgaaaagtcagaccggatcccccagatcctcaatgtggccacagag
ctggagttcaacttagggacaatgccccggatcaactgtgcagctgccgggaatcccttc
ccagtacggggcagcatggaactccgcaagccagacggcaccatgctcctgtctaccaaa
gccattgtggagccagataggaccacagctgagttcgaggtgccccgtttgactcttggg
gacagcgggttctgggaatgccgtgtatcgacgtctggtggccaagatagccggcgcttc
aaggtcaatgtcaaagtacccccagtgcctctgactgcacctcggctcctggccaagcag
agccgccagcttgtggtctccccactggtctccttcggtggggatggacccatctcctct
gtccgcctgcactaccggccccaggacagcatgattacctggtctgccattgtggtggat
cccagtgagaatgtgacattaatgaacctgaagccaaggacaggatacaacgttcgggtg
cagctgagccggccaggggaaggaggagaaggagcctggggtccttcgactctcatgact
acggactgtcctgagcctttgctgcagccgtgggtagagagctggaacgtggagggtcct
gacaggctacgggtgagctggtctctaccctcggtgccactgtctggggatggtttcctg
ctgcgtctgtgggatggggcccggggacaggagaggcgggagaacatctcatccccccag
gcccgcactgccctcctgactggactcacgcctggcacgcactaccaactggatgtgcgg
ctgtatcactgcaccctcctgggccctgcctcaccctctgcgcatgtgcacctgcccctc
agcgggcctccagctccccgccacctccgtgcccaggccctctcagactctgagatccgt
ctgatgtggcagcatcctgaggctccgcctggacctatatccaagtacattgtggagatt
caggtggccgggggctcaggagaccctcagtggatggatgtagacaaacccgaggagacg
agcaccaccgtccgtggtctcaatgccagcacacgctacctcttccgtgtgcgggccagt
gtgcagggtctcggcgactggagcaacacagtggaagagaccacgctgggtaatgggctg
cagagtgcgagcccagtccaagagagccgggtggctgaagacggtctggatcagcagctg
gtcctggctgtggtaggctccgtctctgccacctgcctcaccatcctggctgccctttta
gccctggtgtgtatccgaagaagctgcctacatcggagacataccttcacctaccagtca
ggatcgggtgaagagaccatcctgcagttcagctcagggaccttgacattgacccgacgg
ccaaagccacagcctgagcctttgagttaccctgtgctggagtgggaggacatcaccttt
gaggacctcatcggggaggggaacttcggccaagtgatccgggccatgatcaagaaggac
ggactcaagatgaacgcagccatcaagatgctgaaagagtatgcgtctgaaaatgaccac
cgagactttgcaggggaactagaagttctgtgcaaactaggacaccaccccaatattatc
aacctcttgggggcctgtgagaaccgaggctacttgtatattgcgatcgaatatgccccg
tatggaaacctgctagatttcctgagaaagagcagggtcctggagactgatccagctttt
gctcgagagcatggaacagcctccacactcagctcccggcagctgctgcgctttgccagt
gatgcagccaacgggatgcagtaccttagtgagaagcagttcattcacagggacctggct
gcccgaaatgttctggtcggagagaacctggcctccaagattgcagactttggcctttct
cggggggaggaagtatatgtgaagaagacgatgggccgtcttcctgtgcgttggatggcc
attgagtccctcaactacagcgtctacactaccaagagtgacgtctggtcatttggggtc
ctcctctgggagatagtgagccttggaggcacgccctactgtggcatgacctgtgctgag
ctctacgagaaactgcctcaaggctatcgcatggagcagcctcgaaactgtgatgatgaa
gtgtacgagctgatgcggcagtgctggcgggaccgtccctatgagcgccccccttttgcc
cagattgcactacagttgggccgcatgctggaagccaggaaggcctacgtgaacatgtca
ctgtttgagaactttacctatgcaggcatcgatgccacagctgaggaggcctag

DBGET integrated database retrieval system