KEGG   Rattus norvegicus (rat): 89807
Entry
89807             CDS       T01003                                 

Gene name
Angpt1, Agpt, Agpt1, Ang-1
Definition
(RefSeq) angiopoietin 1
  KO
K05465  angiopoietin 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04066  HIF-1 signaling pathway
rno04151  PI3K-Akt signaling pathway
rno05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    89807 (Angpt1)
   04014 Ras signaling pathway
    89807 (Angpt1)
   04015 Rap1 signaling pathway
    89807 (Angpt1)
   04066 HIF-1 signaling pathway
    89807 (Angpt1)
   04151 PI3K-Akt signaling pathway
    89807 (Angpt1)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    89807 (Angpt1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    89807 (Angpt1)
Cytokines and growth factors [BR:rno04052]
 Growth factors
  Growth factors (RTK binding)
   89807 (Angpt1)
SSDB
Motif
Pfam: Fibrinogen_C
Other DBs
NCBI-GeneID: 89807
NCBI-ProteinID: NP_445998
RGD: 628896
Ensembl: ENSRNOG00000005854
UniProt: O35460
Position
7q31
AA seq 497 aa
MTVFLSFAFFAAILTHIGCSNQRRSPENGGRRYNRIQHGQCAYTFILPEHDGNCRESATE
QYNTNALQRDAPHVETDFSSQKLQHLEHVMENYTQWLQKLENYIVENMKSEMAQIQQNAV
QNHTATMLEIGTSLLSQTAEQTRKLTDVETQVLNQTSRLEIQLLENSLSTYELEKQLLQQ
TNEILKIQEKNSLLEHKILEMEGKHKEELDTLKEEKENLQGLVTRQTFIIQELEKQLSRA
TSNNSVLQKQQLELMDTVHNLVSLCTKEVLLKGGKREEEKPFRDCADVYQAGFNKSGIYT
IYFNNMPEPKKVFCNMDVNEGGWTVIQHREDGSLDFQRGWKEYKMGFGNPSGEYWLGNEF
IFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNQKQNYRLYLKGHTGTAGKQSSLILH
GADFSTKDADNDNCMCKCALMLTGGWWFDACGPSNLNGMFYTAGQNHGKLNGIKWHYFKG
PSYSLRSTTMMIRPLDF
NT seq 1494 nt   +upstreamnt  +downstreamnt
atgacagttttcctttcctttgcattcttcgctgccattctgactcacatagggtgcagc
aaccagcgccggagtccagaaaacggagggagaagatataaccgaattcaacatgggcaa
tgtgcctacactttcattcttccagaacacgacgggaactgccgtgagagtgcgacagag
cagtacaacaccaacgctctgcaaagggatgctccacacgtggagacggatttctcttcc
cagaaacttcagcatctggagcatgtgatggaaaattatactcagtggctgcaaaaactt
gagaattacattgtggaaaatatgaagtcggagatggcccagatacaacagaatgcggtt
caaaaccacacggccaccatgctggagataggaaccagcctcttgtctcagactgcagag
cagacccgaaagctcacagatgtggagacccaggtactaaatcaaacatcccgtcttgaa
atccaactgctggagaattcattatcaacatacgagctagagaaacagcttctccaacag
acaaatgaaattctgaagattcaggaaaaaaacagtttattagagcataaaatcctagaa
atggagggaaaacacaaggaagagctggacaccttgaaggaggagaaagaaaaccttcaa
ggcttggttactcgtcagacattcatcatccaagaattggagaagcaacttagcagagct
accagcaacaacagtgttctgcagaagcaacaactggagctcatggacacagtccataac
cttgtcagcctttgcacaaaagaagttttgctaaagggaggaaaaagagaagaagagaaa
ccatttcgagactgtgcagatgtatatcaagctggttttaataagagtggaatctacact
atttattttaataatatgccagaacccaaaaaggtattttgcaatatggatgtgaatgaa
ggaggatggacagtaatacaacaccgtgaggatggaagcctagatttccagaggggctgg
aaggagtataaaatgggttttgggaatccctctggtgaatattggcttgggaacgagttc
atttttgcaataaccagtcagaggcagtacatgctgaggatcgagctgatggactgggaa
gggaaccgagcctactcacagtacgacagattccacataggaaaccagaagcagaactac
aggttatatttaaagggtcacacggggacagcaggcaaacagagcagcttgatcttacat
ggtgctgatttcagcacaaaggacgctgataacgacaactgtatgtgcaaatgcgccctt
atgctaacaggaggttggtggtttgatgcctgtggcccttccaatctaaacggaatgttc
tacactgcagggcaaaaccatggaaaactgaatgggataaagtggcactacttcaaagga
cccagttactccttacgttccacaaccatgatgatccggcccttggacttctga

DBGET integrated database retrieval system