KEGG   Rattus norvegicus (rat): 89808Help
Entry
89808             CDS       T01003                                 

Gene name
Cx3cl1, Cx3c, Scyd1
Definition
(RefSeq) C-X3-C motif chemokine ligand 1
  KO
K05508  C-X3-C motif chemokine 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
rno04668  TNF signaling pathway
rno05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    89808 (Cx3cl1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    89808 (Cx3cl1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    89808 (Cx3cl1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    89808 (Cx3cl1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    89808 (Cx3cl1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    89808 (Cx3cl1)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Chemokines
   89808 (Cx3cl1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8 CCDC84
Motif
Other DBs
NCBI-GeneID: 89808
NCBI-ProteinID: NP_604450
RGD: 620458
Ensembl: ENSRNOG00000016326
UniProt: O55145
Position
19p13
AA seq 393 aa AA seqDB search
MAPSQLAWLLRLAAFFHLCTLLAGQHLGMTKCNITCHKMTSPIPVTLLIHYQLNQESCGK
RAIILETRQHRHFCADPKEKWVQDAMKHLDHQTAALTRNGGKFEKRVDNVTPRITSATRG
LSPTALAKPESATVEDLTLEPTAISQEARRPMGTSQEPPAAVTGSSPSTSKAQDAGLAAK
PQSTGISEVAAVSTTIWPSSAVYQSGSSLWAEEKATESPPTIALSTQASTTSSPKQNVGS
EGQPPWVQEQDSTPEKSPGPEETNPVHTDIFQDRGPGSTVHPSVAPTSSEKTPSPELVAS
GSQAPKVEEPIHATADPQKLSVFITPVPDSQAATRRQAVGLLAFLGLLFCLGVAMFAYQS
LQGCPRKMAGEMVEGLRYVPRSCGSNSYVLVPV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggctccctcacagctcgcgtggctgctgcgcctggccgcgttctttcatctgtgtact
ctgctggcgggtcagcacctcggcatgacgaaatgcaacatcacgtgccacaagatgacc
tcgccaatcccagtgaccttgctcatccactatcaactgaaccaggagtcctgcggcaag
cgcgccatcatcctggagacgagacagcacagacacttctgtgctgacccaaaggagaaa
tgggtccaagacgccatgaagcacctggaccaccagaccgctgccctgactagaaatggt
ggcaagtttgagaagcgtgtggacaatgtgacacctaggatcacctcggccaccagggga
ctgtccccaactgccctggcaaagcctgagtcagccacagtggaagaccttactttggaa
ccgactgctatttcccaggaggcccgaaggcccatggggacttcccaagagccaccagca
gcagtgactggatcgtctccctcaacttccaaagctcaggatgcagggcttgccgccaag
cctcagagcactggaatttctgaggtggctgctgtctctaccaccatttggccgagttct
gctgtctaccaatctggatctagcctctgggccgaggaaaaagctactgaatcccccccc
actatagccctatctactcaagcgtccaccacttcaagccccaagcagaatgttgggtct
gaaggccagcccccatgggtccaggagcaggactccactccagagaaatctccagggcct
gaggagacaaacccagttcatactgatattttccaagacagaggacctggcagcacagtc
catccctcagtggctcccacctcctctgaaaagacccccagcccggagctggtggcctcg
ggcagccaggctcctaaggtagaggaacccattcatgccactgcagatccccagaaactg
agtgtgtttatcactcctgtccctgactcccaggcagccacccggaggcaggcagtgggg
ttactggcctttcttggtctactcttctgtctgggggtggccatgtttgcctaccagagc
ctccagggctgtccccgcaaaatggcaggggagatggtggaaggcctccgctacgtcccc
cgtagctgtggcagtaactcgtacgtcctggtgccggtgtga

DBGET integrated database retrieval system