KEGG   Rattus norvegicus (rat): 89810
Entry
89810             CDS       T01003                                 

Gene name
Opn1mw
Definition
(RefSeq) opsin 1 (cone pigments), medium-wave-sensitive
  KO
K04251  long/medium wavelength-sensitive opsin
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    89810 (Opn1mw)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Vision
   Opsin
    89810 (Opn1mw)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srw 7TM_GPCR_Srt 7TM_GPCR_Srv 7TM_GPCR_Srsx Cytochrom_B_N_2
Other DBs
NCBI-GeneID: 89810
NCBI-ProteinID: NP_446000
RGD: 620978
Ensembl: ENSRNOG00000051529
UniProt: O35476
Position
Xq37
AA seq 359 aa
MAQQLTGEQTLDHYEDSTQASIFTYTNSNSTRGPFEGPNYHIAPRWVYHLTSTWMILVVI
ASVFTNGLVLAATMRFKKLRHPLNWILVNLAVADLAETIIASTISVVNQIYGYFVLGHPL
CVIEGYIVSLCGITGLWSLAIISWERWLVVCKPFGNVRFDAKLATVGIVFSWVWAAVWTA
PPIFGWSRYWPYGLKTSCGPDVFSGTSYPGVQSYMMVLMVTCCIFPLSIIVLCYLQVWLA
IRAVAKQQKESESTQKAEKEVTRMVVVMVFAYCLCWGPYTFFACFATAHPGYAFHPLVAS
LPSYFAKSATIYNPIIYVFMNRQFRNCILQLFGKKVDDSSELSSTSKTEVSSVSSVSPA
NT seq 1080 nt   +upstreamnt  +downstreamnt
atggcccaacagcttacaggtgaacagacactggaccattatgaggatagcacccaggca
agcatcttcacctataccaacagcaacagcaccagaggtccctttgaaggtcccaattat
cacattgctccaaggtgggtgtaccacctcaccagcacctggatgattcttgtggtcatt
gcatctgtcttcacaaatggactcgtgctggcagccaccatgaggttcaagaagctgcgt
catcctctgaactggattctagtgaacttggcagttgctgacctagcagagaccattatt
gccagcactatcagtgttgtgaaccaaatctatggctactttgtgctgggccaccctctg
tgtgtcatagaaggctacattgtctcactatgtgggatcacaggcctctggtccttggcc
atcatttcctgggagagatggctggtggtctgcaagccctttggcaatgtgagatttgat
gctaaactggccactgtgggaatcgtcttctcctgggtctgggctgctgtatggacggcc
ccaccaatctttggttggagcaggtactggccttatggcctgaagacatcgtgtggtcca
gacgtgttcagcggtacctcgtatcctggggttcagtcttatatgatggtcctcatggtc
acgtgctgcatcttcccactcagcatcatcgtgctctgctacctccaagtgtggctggcc
atccgagcagtggcaaagcaacagaaagaatctgagtccacccagaaggctgagaaggag
gtgacacgcatggtggtggtgatggtcttcgcatactgcctctgctgggggccctatact
ttctttgcatgctttgctactgcccatcctggctatgccttccaccctcttgtggcctcc
ctaccatcctactttgccaaaagtgccactatctacaatcccattatctatgtctttatg
aaccggcagtttcgaaattgcatcttacagctctttggaaagaaagttgatgatagctct
gaactttccagcacctccaaaacagaagtctcatctgtctcttcagtgtcacctgcataa

DBGET integrated database retrieval system