KEGG   Rattus norvegicus (rat): 89811Help
Entry
89811             CDS       T01003                                 

Gene name
Vegfb
Definition
(RefSeq) vascular endothelial growth factor B
  KO
K16858  vascular endothelial growth factor B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno04926  Relaxin signaling pathway
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    89811 (Vegfb)
   04015 Rap1 signaling pathway
    89811 (Vegfb)
   04010 MAPK signaling pathway
    89811 (Vegfb)
   04151 PI3K-Akt signaling pathway
    89811 (Vegfb)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    89811 (Vegfb)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    89811 (Vegfb)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    89811 (Vegfb)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    89811 (Vegfb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    89811 (Vegfb)
Cytokines and growth factors [BR:rno04052]
 Growth factors
  Growth factors (RTK binding)
   89811 (Vegfb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDGF
Motif
Other DBs
NCBI-GeneID: 89811
NCBI-ProteinID: NP_446001
RGD: 619799
Ensembl: ENSRNOG00000021156
UniProt: O35485
Position
1q43
AA seq 186 aa AA seqDB search
MSPLLRRLLLVALLQLACTQAPVSQFDGPSHQKKVVSWIDVYARATCQPREVVVPLSMEL
MGNVVKQLVPSCVTVQRCGGCCPDDGLECVPIGQHQVRMQILMIQYPSSQLGEMSLEEHS
QCECRPKRKESAVKPDSPRTLCPRCTQRRQRPDPRTCRCRCRRRRFLHCQGRGLELNPDT
CRSSET
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgagccccctgctccgtcgcttgctgcttgttgcgctgctgcagctggcctgtacccag
gcccctgtgtcccagtttgatggccccagccaccagaagaaagtggtgtcatggatagat
gtttatgcacgtgccacatgccagcccagggaggtggtggtacctctgagcatggaactc
atgggtaatgtggtcaaacaactcgtgcccagctgtgtgactgtgcagcgctgtggtggc
tgctgtcctgacgatggcctggagtgtgtgcccattgggcaacaccaagtccgaatgcag
atcctcatgatccagtacccgagcagtcagctgggggagatgtccctggaagaacacagc
caatgtgaatgcagaccaaaaagaaaggagagtgctgtgaagccagacagccccaggacc
ctctgcccacgctgcacccagcgccgtcagcgccctgatccccggacctgccgttgccgc
tgcagacgccgccgcttcctccattgccaagggcggggcttagagctcaacccagatacc
tgcagatcatcagaaacttag

DBGET integrated database retrieval system