KEGG   Rattus norvegicus (rat): 89814Help
Entry
89814             CDS       T01003                                 

Gene name
Tnfsf4, Ox40l, Tnlg2b
Definition
(RefSeq) tumor necrosis factor superfamily member 4
  KO
K05469  tumor necrosis factor ligand superfamily member 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    89814 (Tnfsf4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    89814 (Tnfsf4)
   04090 CD molecules [BR:rno04090]
    89814 (Tnfsf4)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Tumor necrosis fators
   89814 (Tnfsf4)
CD molecules [BR:rno04090]
 Proteins
  89814 (Tnfsf4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 89814
NCBI-ProteinID: NP_446004
RGD: 619816
Ensembl: ENSRNOG00000002968
Vega: OTTRNOG00000000193
UniProt: Q9Z2P3 A0A0U5JAD2
Position
13q22
AA seq 199 aa AA seqDB search
MEGEGVQPPDENLENGSRPRFKWKKVLRLVVSGIKAAGLLLCVVYVCLQFSSSPAKDSPI
QRLRAPVTGCEGGRLFIGTSKNEYETMEVQNNSVIINCDGLYLIHLKGSFFQEVKINLHF
RKDRSPIFVPMLNNGQRVVFTVVTSLAFKDEVYLTVNASDTLCEHLQINDGELIIVQLTP
NGYCAPERPYSSTVNQVPL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggaaggggaaggggttcaacccccggatgagaatctggaaaatggatcaaggccaagg
ttcaagtggaagaaggtgctaaggctggtggtctctgggattaaggcagcagggctgctc
ctgtgcgtcgtctatgtctgcctgcaattctcttcatctccggcgaaggactctccaatc
caaagactcagagcaccagttaccggatgtgaggggggaagactattcattggcacatcc
aagaatgagtatgaaaccatggaggtgcagaacaattcggtcatcatcaactgcgatggg
ctttatctcatccacctgaagggctcctttttccaggaggtcaagatcaaccttcatttc
cggaaggatcgcagtccaatctttgtgccaatgctgaacaatggtcaaagggttgttttc
actgtggtgacctctttggcttttaaagacgaagtttacttgactgtaaatgcttctgat
actctctgtgaacacctccagataaatgatggggaactgattattgtccagctaactcct
aatggatactgtgctcctgaaagaccttatagcagcactgtgaaccaagtaccactgtga

DBGET integrated database retrieval system