KEGG   Rattus norvegicus (rat): 89816
Entry
89816             CDS       T01003                                 

Gene name
Picalm
Definition
(RefSeq) phosphatidylinositol-binding clathrin assembly protein
  KO
K20044  phosphatidylinositol-binding clathrin assembly protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    89816 (Picalm)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    89816 (Picalm)
SSDB
Motif
Pfam: ANTH ENTH
Other DBs
NCBI-GeneID: 89816
NCBI-ProteinID: NP_446006
RGD: 621054
Ensembl: ENSRNOG00000018322
Vega: OTTRNOG00000002338
UniProt: O55012
Structure
PDB: 

Position
1
AA seq 640 aa
MSGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLA
DSLFERTTNSSWVVVFKSLITTHHLMVYGNERFIQYLASRNTLFNLSNFLDKSGLQGYDM
STFIRRYSRYLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLD
FNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKYFDMKKNQCKEGLDIYKKF
LTRMTRISEFLKVAEQVGIDRGDIPDLSQAPSSLLDALEQHLASLEGKKIKDSTAASRAT
TLSNAVSSLASTGLSLTKVDEREKQAALEEEQARLKALKEQRLKELAKKPHTSLTTAASP
VSTSAGGIMTAPAIDIFSTPSSSNSTSKLPNDLLDLQQPTFHPSVHAMSAAPQVASTWGD
AVDDAIPSLNPFLTKSSGDVHLPISSDVSTFTTRTPTHEMFVGFSPSPVTQPHPSAGLNV
DFESVFGNKSTNVAVDSGGGLLKPTVASQNQSLPVAKLPPNKLVSDDLDSSLANLVGNLG
IGNGTTKNDVSCSQPGEKKLTGGSNWQPKVAPTTAWSAATMAPPVMAYPATTPTGMIGYG
IPPQMGSVPVMTQPTLIYSQPVMRPPNPFGPVPGAQIQFM
NT seq 1923 nt   +upstreamnt  +downstreamnt
atgtctggccagagcctgacggaccgaatcaccgcggcccagcacagtgtcactggctcc
gcggtatctaagacagtatgcaaggccacgacccacgagatcatgggccccaagaaaaag
cacctggactacttaattcagtgtacaaatgagatgaatgtgaatatcccacagttggca
gacagtttgtttgaaagaactactaatagtagttgggtggtggtcttcaaatcactcatt
acaactcatcatttgatggtgtatggaaacgagcgtttcattcagtatttggcttcaaga
aacacattgtttaacttaagcaactttttggataaaagtggattgcaaggatatgatatg
tctacatttattagacgatatagtaggtacctaaatgaaaaggcagtttcatacagacaa
gttgcattcgatttcacaaaagtgaagagaggagctgatggagttatgagaacaatgaac
acagaaaaactgttaaaaactgtaccaattatccaaaatcaaatggatgcacttcttgat
tttaatgttaatagtaatgaacttacaaatggggtaataaatgctgccttcatgctcctg
ttcaaagatgccattagactatttgcagcatacaatgaaggaattattaatttattggaa
aaatattttgatatgaaaaagaaccagtgcaaagaaggtcttgacatctataagaagttt
ttgactaggatgacaagaatctcagagtttctgaaagttgcagagcaagttggaattgac
agaggagatattccagatctttcacaggcccccagcagtcttcttgatgctttagaacaa
catttagcttccttggaagggaagaaaatcaaagattccacagctgcaagcagggctaca
acactttccaatgcagtctcttctttggcaagcactggcctatctctgaccaaagtggat
gaaagggaaaagcaggcagcattagaggaagaacaggctcgattaaaagcactaaaggaa
cagcgtctaaaagaacttgcaaagaaaccgcatacctctttaacaactgcagcctctcct
gtgtccacctcagcagggggaataatgactgcaccagccatcgacatattttctacccct
agttcttctaacagcacatccaagctgccaaatgacctgcttgatttgcagcagccaacc
tttcatccatctgtccatgctatgtcagctgctcctcaggtagcaagtacatggggagat
gctgttgatgatgccattccaagcttaaatcctttcctcacaaaaagtagtggtgatgtt
caccttcctatttcttcagatgtatccacttttactactaggacacctactcatgaaatg
tttgttggattcagtccttctccggttacacagccacatccttcagctggccttaatgtt
gactttgaatctgtgtttggaaataagtctacgaatgttgctgtagattctggtggtgga
cttctcaaaccaacagtggcctctcagaaccagagtcttcctgttgccaaacttccgcct
aacaaattagtgtctgatgacttggattcatctttagccaaccttgtgggcaatcttggc
attggaaatggaaccactaagaatgatgtaagttgcagtcaaccaggtgaaaagaagtta
actggaggatctaactggcaaccaaaggtcgcaccaacaactgcctggagtgctgcaaca
atggcaccccctgtaatggcctatcctgctactacaccaacgggcatgataggatatgga
attcctcctcagatgggaagtgtacctgtaatgacacagccaaccttaatatacagccag
cctgtcatgagaccgccaaacccctttggccctgtaccaggagcacagatacagtttatg
taa

DBGET integrated database retrieval system