KEGG   Rattus norvegicus (rat): 89817Help
Entry
89817             CDS       T01003                                 

Gene name
Sh2b1, Sh2-b, Sh2b, Sh2bpsm1
Definition
(RefSeq) SH2B adaptor protein 1
  KO
K12459  SH2B adaptor protein 1/3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04722  Neurotrophin signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    89817 (Sh2b1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phe_ZIP SH2 PH PI3K_rbd
Motif
Other DBs
NCBI-GeneID: 89817
NCBI-ProteinID: NP_604451
RGD: 620132
Ensembl: ENSRNOG00000049181
UniProt: Q62985
Position
1q36
AA seq 756 aa AA seqDB search
MNGAPSPEDGVFPSPPALPPPPPPSWQEFCESHARAAALDLARRFRLYLASHPQYAEPGA
EAAFSGRFAELFLQHFEAEVARASGSLSPPVLAPLSPGVEIPPSHDLSLESCRVGGPLAV
LGPSRSSEDLAGPLPSSVSSSTTSSKPKLKKRFSLRSVGRSVRGSVRGILQWRGAVESPS
QAGPLETTSGPPVLGGNSNSNSSGGAGTVGRALANDGTSPGERWTHRFERLRLSRGGGTL
RDGAGVIQREELLSFMGAEEAAPDPAGVGRGGGAAGLTSGGGGQPQWQKCRLLLRSEGEG
GGGSRLEFFVPPKASRPRLSIPCSTITDVRTATALEMPDRENTFVVKVEGPSEYILETTD
ALHVKAWVSDIQECLSPGPCPAISPRPMTLPLAPGTSFLTKDNTESLELPCLNHSESLPS
QDLLLGPSESNDRLSQGAYGGLSDRPSASFSPSSASIAASHFDSMELLPPELPPRIPIEE
GPPAGTVHPLSTPYPPLDTPEAATGSFLFQGEAEGGEGDQPLSGYPWFHGMLSRLKAAQL
VLEGGTSSHGVFLVRQSETRRGEYVLTFNFQGKAKHLRLSLNEEGQCRVQHLWFQSIFDM
LEHFRVHPIPLESGGSSDVVLVSYVPSQRQQERSTSRDPTQPSEPPPWTDPPHPGAEEAS
GAPEVAAATAAAAKERQEKEKAGGGGVQEELVPMAELVPMAELEEAIAPGTEAQGGAGSS
GDLEVSLMVQLQQLPLGGNGEEGGHPRAINNQYSFV
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atgaatggtgccccttccccagaggatggggttttcccttctccaccagcgctgccacca
ccccctcccccaagttggcaagagttctgtgagtcccatgcgagggctgctgccctggat
cttgctcgccgttttcgcctctatctggcctcccacccacaatatgcagagccgggagca
gaggctgccttttctggccgttttgctgagctcttcctgcagcacttcgaagctgaggtg
gctcgggcctcgggctcactctccccacctgtcttggctccattgagccctggtgtggaa
atcccaccatcacatgacctgtcccttgagagctgcagggtgggtgggcccctggcagtg
ttgggcccttctcgatcttctgaggacctggctggcccccttccttcctcagtctcttcc
tctacaacgtcctcaaagccgaagctcaagaaacgcttctccctccgctcggtgggtcgt
tcagtcagaggttctgtccgaggcatcctgcagtggcggggggctgttgaatctccctcc
caagctgggcctctggagaccacatcaggtcctccagttctaggtggaaacagcaactcc
aactcctctggtggtgctgggacagttggtagggcattggccaacgatggcacatcccct
ggggagagatggactcatcgctttgagaggctaaggctaagtcgtggagggggaaccttg
agagacggagcaggagtgatacagagagaagagctgctgagtttcatgggggctgaagag
gctgcccctgacccagcaggagtaggtcgtggaggaggggcagctgggctgacctcggga
ggaggagggcagcctcagtggcagaaatgtcgattactgctccggagtgaaggagaagga
ggaggaggaagtcgcttggagttctttgtaccacccaaggcatcccggccccgtcttagc
attccctgttctactattactgatgtccgcacagccacagccctggagatgcctgacagg
gagaacacgtttgtggttaaggtagaaggcccttcagagtacatcctggagacaactgat
gcacttcatgtgaaggcctgggtgtctgacatccaagagtgcctaagcccaggaccctgc
cctgctatcagcccccgtcccatgacccttcccctggcccctgggacctccttcctcaca
aaggataacacagagagcctggagttgccctgcctgaatcattcagagagtctgcctagc
caggatcttcttctgggacccagcgagagtaacgaccgcctgtcgcagggagcttatgga
ggcctctcagaccggccgtcagcgtccttctcccctagttctgcctccattgctgcttcc
cattttgactcaatggaactgcttcctccagagttgccccctcggattcccattgaggag
gggcctccagcagggacagttcatcccctctctaccccgtaccctcccctggatactcct
gaagcagccacagggtcattcctctttcaaggggaggcagaggggggtgagggggaccag
cccctctcaggctacccttggttccacggcatgctctctcggctcaaagctgcccagtta
gtgttagaaggaggtaccagctcccatggtgtcttcttggtacgccagagtgagacaaga
cgtggtgaatatgtcctcactttcaacttccagggcaaggctaagcacctgcgtttgtca
ctaaatgaggagggtcagtgccgggtccaacatctgtggttccagtccattttcgatatg
cttgagcacttccgggtgcaccccatccctctggagtctggaggctccagtgatgttgtc
cttgtcagctatgtgccctcccagcggcagcaggaacggagcacctcccgtgatccaacc
cagccctctgaaccccctccatggacagatcccccacatcctggggcagaagaggcgtcg
ggggcgccagaagtggcggcagccacagccgcagcagccaaagagaggcaagagaaggag
aaagcgggcggcggaggggtccaggaagagctggtccccatggctgagctggtccccatg
gctgaattggaagaggccatagcaccaggcactgaggctcagggtggtgctggctctagt
ggggacttggaggtgtccctaatggttcagctccagcagttaccactagggggcaacgga
gaagaagggggtcacccccgagccattaataaccagtactcatttgtctga

DBGET integrated database retrieval system