KEGG   Rattus norvegicus (rat): 89821Help
Entry
89821             CDS       T01003                                 

Gene name
Trpc1, Trrp1
Definition
(RefSeq) transient receptor potential cation channel, subfamily C, member 1
  KO
K04964  transient receptor potential cation channel subfamily C member 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04360  Axon guidance
rno04724  Glutamatergic synapse
rno04726  Serotonergic synapse
rno04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    89821 (Trpc1)
  09156 Nervous system
   04724 Glutamatergic synapse
    89821 (Trpc1)
   04726 Serotonergic synapse
    89821 (Trpc1)
  09158 Development
   04360 Axon guidance
    89821 (Trpc1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    89821 (Trpc1)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   89821 (Trpc1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRP_2 Ion_trans Ank_2 Ank_4
Motif
Other DBs
NCBI-GeneID: 89821
NCBI-ProteinID: NP_446010
RGD: 619783
Ensembl: ENSRNOG00000054902
UniProt: Q9QX01
Position
8q31
AA seq 759 aa AA seqDB search
MMAALYPSTDLSGVSSSSLPSSPSSSSPNEVMALKDVREVKEENTLNEKLFLLACDKGDY
YMVKKILEENSSGDLNINCVDVLGRNAVTITIENESLDILQLLLDYGCQKLMERIQNPEY
STTMDVAPVILAAHRNNYEILTMLLKQDVALPKPHAVGCECTLCSAKNKKDSLRHSRFRL
DIYRCLASPALIMLTEEDPILRAFELSADLKELSLVEVEFWNDYEELARQCKMFAKDLLA
QARNSRELEVILNHTSSDEPLDKRGLLEERMNLSRLKLAIKYNQKEFVSQSNCQQFLNTV
WFGQMSGYRRKPTCKKIMTVLTVGIFWPVLSLCYLIAPKSQFGRIIHTPFMKFIIHGASY
FTFLLLLNLYSLVYNEDKKNTMGPALERIDYLLILWIIGMIWSDIKRLWYEGLEDFLEES
RNQLSFVMNSLYLATFALKVVAHNKFHDFADRKDWDAFHPTLVAEGLFAFANVLSYLRLF
FMYTTSSILGPLQISMGQMLQDFGKFLGMFLLVLFSFTIGLTQLYDKGYTSKEQKDCVGI
FCEQQSNDTFHSFIGTCFALFWYIFSLAHVAIFVTRFSYGEELQSFVGAVIVGTYNVVVV
IVLTKLLVAMLHKSFQLIANHEDKEWKFARAKLWLSYFDDKCTLPPPFNIIPSPKTICYM
ISSLSKWVCSHTSKGKVRRQNSLKEWRNLKQKRDENYQKVMCCLVHRYLTSMRQKMQSTD
QATVENLNELRQDLSKFRNEIRDLLGFRTSKYAMFYPKN
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
atgatggcggccctgtacccgagcacggacctctctggcgtctcctcctcctccctgcct
tcctccccatcctcctcatcgcccaacgaagtgatggcgctgaaggatgtgcgagaggtg
aaggaggagaacaccttgaatgagaagcttttcttgctggcgtgcgacaagggtgactat
tatatggttaaaaagattttggaggaaaacagttcaggtgacttgaacataaattgcgta
gatgtgcttgggagaaatgctgttaccataactattgaaaacgaaagcttggatatactg
cagctgcttttggactacggttgtcagaaacttatggaacgaattcagaatccggaatac
tcaacaacaatggatgttgcaccagttattttagctgctcatcgtaacaactatgagatc
ctcacaatgcttctgaagcaggacgtggctttgcccaagccccatgctgttggctgtgaa
tgcacgctgtgttctgcgaaaaacaaaaaggacagcctcagacattccaggtttcgtctt
gatatctatagatgtctggccagtccagctctaataatgttaacagaggaggatccaatt
ctgagagcgtttgaacttagtgctgacttaaaggaactcagccttgtggaggtggaattc
tggaatgactatgaagagctagcccgtcagtgcaaaatgtttgctaaagatttgcttgcg
caagctcggaattctcgtgaactggaagttatcctaaaccatacatctagtgatgagcct
cttgacaaacgaggactactagaagaaagaatgaatttaagtcgtctgaaacttgctatc
aaatataaccagaaggagtttgtctcccagtcaaattgccagcagttcctgaacaccgtt
tggttcggacagatgtcaggttaccgccgtaagcccacctgtaagaagataatgactgtt
ttgacagttggcattttctggccagttctgtcactgtgttacttgatagctcccaaatct
caattcggcagaatcattcacacaccgttcatgaagtttattattcatggagcttcatat
ttcacattcttgctgttactcaatctctactcacttgtctacaatgaggacaagaaaaat
acaatggggccagcccttgagagaatagactaccttctcatactgtggattattgggatg
atttggtcagacattaagaggctgtggtatgaagggttggaagacttcttagaagaatct
cgtaaccagctcagctttgttatgaattccctttacttggcaacttttgccctcaaagtg
gtggctcacaacaagtttcatgattttgccgaccggaaggactgggatgcgttccacccc
acactggtagcagaagggcttttcgcctttgcaaacgttctgagttaccttcggctcttc
tttatgtacacaaccagctctattttgggcccactgcagatttcaatgggacagatgtta
caagattttgggaaatttctaggaatgttccttcttgttctgttttccttcacgattgga
ctgacacagctctatgacaaagggtacacttccaaagagcagaaggactgcgtaggcatc
ttctgtgaacagcaaagcaacgacaccttccactcgttcattggcacctgctttgctctg
ttctggtacatcttctccttagcgcatgtggccatctttgtcaccaggtttagctatggg
gaagaactgcagtccttcgttggggctgtgattgtcggaacttacaatgtcgtggttgtg
atcgtgcttacaaagctactggtagcgatgcttcataagagcttccagctgatagcaaat
catgaggataaagaatggaagtttgctcgagcgaagctatggctcagctactttgatgac
aaatgcacactgcccccacctttcaacatcattccttctccgaagactatctgctatatg
atcagcagcctcagcaagtgggtgtgctcgcacacctccaaaggcaaggtcagacggcag
aacagcttgaaggagtggagaaacttaaaacaaaagagagatgagaactaccagaaggtg
atgtgctgcctagtgcatcgatacctgacctccatgcgacagaagatgcagagcacagac
caagccaccgtggagaatctcaatgaactgcgccaagatctgtcaaaattccgaaatgaa
ataagggatttgcttggctttcggacttctaaatatgctatgttttatcccaaaaattag

DBGET integrated database retrieval system