KEGG   Rattus norvegicus (rat): 89824Help
Entry
89824             CDS       T01003                                 

Gene name
Chi3l1, CGP-39, Chil1, GP-39
Definition
(RefSeq) chitinase 3 like 1
  KO
K17523  chitinase-3-like protein 1/2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:rno04091]
    89824 (Chi3l1)
Lectins [BR:rno04091]
 Chitinase-like lectins
  89824 (Chi3l1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_18
Motif
Other DBs
NCBI-GeneID: 89824
NCBI-ProteinID: NP_446012
RGD: 620874
Ensembl: ENSRNOG00000053272
UniProt: Q9WTV1
Position
13q13
AA seq 381 aa AA seqDB search
MTLQLPGFAVLMLLQSCSAYKLVCYYTNWSQYREGNGSCFPDALDHSLCTHIIYSFANIS
NNKLSTSEWNDVTLYGMLNTLKTRNPRLKTLLSVGGWSFGSERFSRIVSNAKSRKTFVQS
VAPFLRTYGFDGLDLAWLYPGPKDKQHFTTLIKELKAEFTKEVQPGTEKLLLSAAVSAGK
VTLDSGYDVAQIAQHLDFINLMTYDFHGTWRHTTGHHSPLFRGQQDTGPDRFSNVDYGVG
YMLRLGAPTNKLVMGIPTFGKSFTLASSENQVGAPITGSGLPGRYTKEKGTLAYYEICDF
LRGAEVHRILGQQVPFATKGNQWVGYDDPESVKNKVKYLKNKQLAGAMVWAVDLDDFRGS
FCGHNVHFPLTNAIKEALAVA
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgacccttcagctgccaggctttgcggtcctgatgctgctccagagctgctctgcgtac
aaactggtctgctactacaccaactggtcccagtaccgggaaggcaatgggagctgcttc
ccagatgccctcgaccattccctgtgcacccatatcatctacagctttgccaacatcagc
aacaacaagctcagcacatcggagtggaatgacgtaaccctgtatggcatgctgaatact
ctcaagaccagaaaccccagactgaagacactgctgtctgttggaggatggagctttggc
tcagaaagattttccaggattgtctccaacgctaagagtcgcaagactttcgtccagtcg
gtagctcccttcctgcggacctatggctttgatggactggatctcgcctggctctacccg
ggcccgaaagacaagcaacattttaccacactgatcaaggaactgaaggcggaattcaca
aaggaagtccagccaggcacagagaaactcctgctcagtgctgccgtgtcagcaggaaag
gtgacccttgacagtggctatgatgttgcccagatagcccaacacctagatttcattaat
ctcatgacctatgatttccatggaacctggcgccacaccacaggacatcacagccccctc
ttccgaggccagcaggacactgggcctgacagattcagcaatgtggactatggtgtgggg
tacatgctaaggctgggagcccccaccaacaagctagtgatgggtatccccacctttgga
aagagcttcactctggcatcttctgagaatcaagtgggagctccaatcacagggtcagga
ttaccaggccgctacaccaaggagaaagggaccctcgcctactacgagatatgcgacttc
ctcagaggagctgaagtacatagaattcttggccagcaggttccctttgctaccaagggc
aaccagtgggtggggtatgatgacccggagagcgtcaaaaacaaggtgaagtacctgaag
aacaagcagctggcaggagccatggtgtgggcagtggatttggatgatttccggggctcc
ttctgtgggcataacgtacacttcccgctcaccaacgccatcaaggaggccctggctgtg
gcttag

DBGET integrated database retrieval system