KEGG   Rattus norvegicus (rat): 89825
Entry
89825             CDS       T01003                                 

Gene name
Nap1l1
Definition
(RefSeq) nucleosome assembly protein 1-like 1
  KO
K11279  nucleosome assembly protein 1-like 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    89825 (Nap1l1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histone chaperones
    NAPs (Nucleosome assembly proteins)
     89825 (Nap1l1)
SSDB
Motif
Pfam: NAP
Other DBs
NCBI-GeneID: 89825
NCBI-ProteinID: NP_446013
RGD: 71094
Ensembl: ENSRNOG00000003890
UniProt: Q9Z2G8 G3V6H9
Position
7q22
AA seq 391 aa
MADIDNKEQSELDQDLEDVEEVEEEETGEETKIKARQLTVQMMQNPQILAALQERLDGLV
DTPTGYIESLPKVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLYQPLFDKRFEI
INAIYEPTEEECEWKPDEEDEVSEELKEKAKIEDEKKDEEKEDPKGIPEFWLTVFKNVDL
LSDMVQEHDEPILKHLKDIKVKFSDAGQPMSFILEFHFEPNEYFTNEVLTKTYRMRSEPD
DSDPFSFDGPEIMGCTGCQIDWKKGKNVTLKTIKKKQKHKGRGTVRTVTKTVSNDSFFNF
FAPPEVPENGDLDDDAEAILAADFEIGHFLRERIIPRSVLYFTGEAIEDDDDDYDEEGEE
ADEEGEEEGDEENDPDYDPKKDQNPAECKQQ
NT seq 1176 nt   +upstreamnt  +downstreamnt
atggcagacattgacaacaaagaacagtctgaacttgatcaagatttggaagatgttgaa
gaagtagaagaagaagaaacgggtgaagaaacaaaaatcaaagcacgtcagctaactgtt
cagatgatgcaaaatcctcagattcttgcagctcttcaggaaagacttgatggtctggta
gacacaccaacaggatacattgaaagcttgcctaaggtagtcaaaagacgggtgaatgct
ctcaagaatcttcaagttaaatgtgcacagatagaagccaaattctatgaggaagttcat
gaccttgagagaaagtatgctgttctctatcagcctctgtttgataagcgatttgagatc
attaatgcaatttatgaacctacagaagaagaatgtgaatggaaaccagatgaggaagat
gaagtttcggaggagctgaaagaaaaggccaagattgaagatgagaaaaaggatgaagaa
aaagaagaccctaaaggaattcctgagttttggttgacagtttttaagaatgttgatttg
ctcagtgatatggttcaggaacatgacgaacctattctgaagcacttgaaagatattaaa
gtgaagttttcggacgctggccagcctatgagttttatcttagaatttcactttgaaccc
aacgaatatttcacaaatgaagtgttaacaaagacttacaggatgaggtcagaaccagat
gattctgatcccttttcttttgatggaccagaaattatgggttgtacagggtgccagata
gattggaaaaaaggaaagaatgttactttgaaaaccattaagaagaagcagaaacacaag
ggccgtgggacagttcgtactgtgactaaaacagtttccaatgattctttctttaacttt
tttgctcctcctgaagttcctgagaatggagatctggatgacgatgctgaggcaatactg
gctgcagactttgaaattggtcactttttacgtgagcgtataatcccaagatcagtgtta
tacttcactggagaagctattgaggacgatgacgatgactatgatgaagaaggtgaagaa
gctgatgaggaaggggaagaagaaggagatgaggaaaacgatccagactatgacccaaag
aaggatcaaaacccagccgagtgcaagcagcagtga

DBGET integrated database retrieval system