KEGG   Rattus norvegicus (rat): 89829Help
Entry
89829             CDS       T01003                                 

Gene name
Socs3, Cish3, Socs-3, Ssi-3
Definition
(RefSeq) suppressor of cytokine signaling 3
  KO
K04696  suppressor of cytokine signaling 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04120  Ubiquitin mediated proteolysis
rno04380  Osteoclast differentiation
rno04630  Jak-STAT signaling pathway
rno04668  TNF signaling pathway
rno04910  Insulin signaling pathway
rno04917  Prolactin signaling pathway
rno04920  Adipocytokine signaling pathway
rno04930  Type II diabetes mellitus
rno04931  Insulin resistance
rno04932  Non-alcoholic fatty liver disease (NAFLD)
rno05160  Hepatitis C
rno05164  Influenza A
rno05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    89829 (Socs3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    89829 (Socs3)
   04668 TNF signaling pathway
    89829 (Socs3)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    89829 (Socs3)
   04920 Adipocytokine signaling pathway
    89829 (Socs3)
   04917 Prolactin signaling pathway
    89829 (Socs3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    89829 (Socs3)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    89829 (Socs3)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    89829 (Socs3)
   04931 Insulin resistance
    89829 (Socs3)
  09172 Infectious disease: viral
   05164 Influenza A
    89829 (Socs3)
   05160 Hepatitis C
    89829 (Socs3)
   05168 Herpes simplex virus 1 infection
    89829 (Socs3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    89829 (Socs3)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     89829 (Socs3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SH2 SOCS_box
Motif
Other DBs
NCBI-GeneID: 89829
NCBI-ProteinID: NP_446017
RGD: 621087
Ensembl: ENSRNOG00000002946
UniProt: O88583
Position
10q32.2
AA seq 225 aa AA seqDB search
MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLL
SAEPAGTFLIRDSSDQRHFFTLSVETQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCV
LKLVHHYMPPPGAPSFSLPPTEPSFEVQEQPPAQALPGGTPKRAYYIYSGGEKIPLVLSR
PLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggtcacccacagcaagtttcccgccgccgggatgagccgccccctggacaccagcctg
cgcctcaagaccttcagctccaagagcgagtaccagctggtggtgaacgccgtgcgcaag
ctgcaggagagcggattctactggagtgccgtaaccggcggcgaggcgaacctgctgctc
agcgccgagcccgcgggcacctttcttatccgcgacagctcggaccagcgccacttcttc
acactgagcgtcgagacccagtcggggaccaagaacctacgcatccagtgcgaggggggc
agcttttcgctgcagagtgacccccggagcacgcagccagtgccccgctttgactgtgta
ctcaagttggtgcaccactacatgccgcccccaggggccccttccttttctttaccaccg
acggaaccttcctttgaggttcaggagcagccacctgcccaggcactccccgggggtacc
cccaagagagcttactacatctattctgggggcgagaagatcccgctggtactgagccga
cctctctcctccaacgtggctaccctccagcatctttgtcggaagactgtcaacggtcac
ctggactcctatgagaaagtgacccagctgcctggacccattcgggagttcctggaccag
tatgatgctccactttaa

DBGET integrated database retrieval system