KEGG   Rattus norvegicus (rat): 89830
Entry
89830             CDS       T01003                                 

Gene name
Ptch1
Definition
(RefSeq) protein patched homolog 1 isoform 2
  KO
K06225  patched 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04024  cAMP signaling pathway
rno04340  Hedgehog signaling pathway
rno04360  Axon guidance
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    89830 (Ptch1)
   04024 cAMP signaling pathway
    89830 (Ptch1)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    89830 (Ptch1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    89830 (Ptch1)
   05205 Proteoglycans in cancer
    89830 (Ptch1)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    89830 (Ptch1)
SSDB
Motif
Pfam: Patched Sterol-sensing MENTAL
Other DBs
NCBI-GeneID: 89830
NCBI-ProteinID: NP_001376185
RGD: 621425
Ensembl: ENSRNOG00000019354
Position
17
AA seq 1382 aa
MGKATGRKAPLWLRAKFQRLLFKLGCYIQKNCGKFLVVGLLIFGAFAVGLKAANLETNVE
ELWVEVGGRVSRELNYTRQKIGEEAMFNPQLMIQTPKEEGANVLTTEALLQHLDSALQAS
RVHVYMYNRQWKLEHLCYKSGELITETGYMDQIIEYLYPCLIITPLDCFWEGAKLQSGTA
YLLGKPPLRWTNFDPLEFLEELKKINYQVDSWEEMLNKAEVGHGYMDRPCLNPADPDCPA
TAPNKNSTKPLDVALVLNGGCQGLSRKYMHWQEELIVGGTVKNATGKLVSAHALQTMFQL
MTPKQMYEHFRGYDYVSHINWNEDRAAAILEAWQRTYVEVVHQSVAPNSTQKVLSFTTTT
LDDILKSFSDVSVIRVASGYLLMLAYACLTMLRWDCSKSQGAVGLAGVLLVALSVAAGLG
LCSLIGISFNAATTQVLPFLALGVGVDDVFLLAHAFSETGQNKRIPFEDRTGECLKRTGA
SVALTSISNVTAFFMAALIPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMDLYRREDR
RLDIFCCFTSPCVSRVIQVEPQAYTEPHSNTRYSPPPPYSSHSFAHETHITMQSTVQLRT
EYDPHTHVYYTTAEPRSEISVQPVTITQDTLSCQSPESTSSTRDLLSQFSDSSLHCLEPP
CTKWTLSSFAEKHYAPFLLRPKAKVVVILLFLGLLGVSLYGTTRVRDGLDLTDIVPRETR
EYDFIAAQFKYFSFYNMYIVTQKADYPNIQHLLYDLHKSFSSVKYVMLEENKQLPQMWLH
YFRDWLQGLQDAFDSDWETGRIMPNNYKNGSDDGVLAYKLLVQTGSRDKPIDISQLTKQR
LVDADGIINPSAFYIYLTAWVSNDPVAYAASQANIRPHRPEWVHDKADYMPETRLRIPAA
EPIEYAQFPFYLNGLRDTSDFVEAIEKVRVICNNYTSLGLSSYPNGYPFLFWEQYISLRH
WLLLAISVVLACTFLVCAVFLLNPWTAGIIVMVLALMTVELFGMMGLIGIKLSAVPVVIL
IASVGIGVEFTVHVALAFLTAIGDKNHRAMLALEHMFAPVLDGAVSTLLGVLMLAGSEFD
FIVRYFFAVLAILTVLGVLNGLVLLPVLLSFFGPCPEVSPANGLNRLPTPSPEPPPSVVR
FAVPPGHTNNGSDSSDSEYSSQTTVSGISEELRHYEAQQGTGGPAHQVIVEATENPVFAR
STVVHPDSRHQPPLNSRQQPHLDSGSLSPGRQGQQPRRDPPREGLRPPPYRPRRDAFEIS
TEGHSGPSNRDRSGPHGARSHNPRNPTSTAMGSSVPSYCQPITTVTASASVTVAVHPPPG
PGRNPRGGPCPGYESYPETDHGVFEDPHVPFHVRCERRDSKVEVIELQDVECEERPWGSS
SN
NT seq 4149 nt   +upstreamnt  +downstreamnt
atggggaaggctactggccggaaagcgccgctgtggctgagagcgaagtttcaaagactc
ttatttaaactgggttgttacattcaaaagaactgcggcaagtttttggttgtgggtctc
ctcatatttggggccttcgctgtgggattaaaggcagctaatctcgagaccaacgtggag
gagctgtgggtggaagttggtggacgagtgagtcgagaattaaattatacccgccagaag
ataggagaagaggctatgtttaatcctcaactcatgattcagactccaaaagaagaaggc
gctaatgtcctgaccacagaggccctactacaacacctggactcagcactccaggccagc
cgtgtgcacgtctacatgtataacaggcaatggaagttggaacatttatgctacaaatca
ggggaacttatcacagagacaggctacatggatcagataatagaatacctttacccttgc
ttaatcattacacctttggactgcttctgggaaggggcaaagctacagtccgggacagcg
tacctcctaggtaagcctcctttacggtggacaaactttgaccccttggaattcctagaa
gagttaaagaaaataaactaccaagtggacagttgggaggaaatgctgaataaagccgaa
gttggccatgggtacatggaccggccttgcctcaatccagccgacccagattgccctgcc
acagcccccaacaaaaattcaaccaaacctcttgatgtggcccttgttttgaacggtgga
tgtcaaggtttatccaggaagtatatgcattggcaggaggagttgattgtgggtggcacc
gtcaagaacgccactggaaagcttgtcagcgctcatgccctgcaaaccatgttccagtta
atgactcccaagcaaatgtatgaacacttcaggggctacgactatgtctctcacatcaac
tggaatgaggatagggcagccgccatcctggaggcatggcagaggacttacgtggaggtg
gttcatcaaagtgttgccccaaactccactcaaaaggtgctttccttcaccaccacgacc
ctggacgacatcctaaaatccttctctgatgtcagtgtcatccgagtggccagtggctac
ctactgatgcttgcctatgcctgtttaaccatgctgcgctgggactgctccaagtcccag
ggtgccgtggggttggctggtgtcctgttggttgcactgtcagtggctgcaggattgggc
ctctgctccttgattggcatttcctttaatgctgcaacaactcaggttttgccatttctt
gcccttggtgttggtgtggacgacgtctttctcctggcccatgcattcagtgaaacggga
cagaataagaggattccatttgaggacaggactggggagtgcctcaagcgcacgggagcc
agcgtggccctcacctccatcagcaatgtcactgccttcttcatggctgcattaatccct
attcctgcactgcgagcgttctccctccaggctgctgtggtggtggtattcaattttgcc
atggttctactcattttccctgcaattctcagcatggatttatacagacgtgaggacaga
agattggatattttctgctgtttcacaagcccctgtgtcagccgggtgattcaagttgaa
ccgcaggcctacacagagcctcatagtaacacccggtacagccccccacccccgtacagc
agccacagcttcgcccatgaaacccacatcaccatgcagtccaccgttcagctccgcaca
gaatatgaccctcacacacacgtctactacaccaccgccgagccgcgctctgagatctct
gtacagcctgtcaccatcacccaggacaccctcagctgtcagagccctgagagcaccagt
tccacccgggacctgctttctcaattctctgactccagcctccactgccttgagcccccc
tgcaccaagtggacactttcttcgtttgcagagaagcactacgctcctttcctcttgaga
cccaaagccaaggttgtggtaatccttcttttcctgggcttgctgggcgtcagcctttat
gggaccacccgagtgagagacgggctggacctcacggacattgtcccccgggaaaccaga
gaatatgacttcatagctgcccagttcaagtacttctctttctacaacatgtatatagtc
acccagaaagcagactacccaaatatccaacacctgctttacgaccttcataagagtttc
agcagtgtgaagtatgtcatgctggaggagaacaagcaacttccccaaatgtggctgcat
tactttagagactggctccaaggacttcaggatgcatttgacagtgactgggaaaccggg
aggatcatgccaaacaattataaaaatggatctgatgatggggtcctcgcttacaaactc
ctggtgcagactggcagccgagacaagcccatcgacattagtcagttgactaaacagcgt
ctggtggacgcagatggcatcattaatccgagcgctttctacatctacctgaccgcttgg
gtcagcaatgaccctgtagcttacgctgcctcccaggccaacatccggcctcacagacca
gagtgggtgcacgacaaagctgactacatgccagagaccaggctgagaatcccagcagca
gagcccatagagtacgctcagttccctttctacctcaacggcctacgggacacctcagac
tttgtggaagccatagaaaaagtgagagtcatctgtaacaactacacgagtctggggctg
tccagctaccccaatggctaccccttcctgttctgggagcagtacatcagcctgcgtcac
tggctgctgctagccatcagcgtggtgctggcctgcacatttctagtgtgcgcagtcttc
ctcctgaacccctggacggccgggatcattgtcatggtcctggctttgatgaccgttgag
ctcttcggcatgatgggcctcattgggatcaagctgagtgctgtgccggtggtcatcctg
attgcgtctgttggcattggagtagaattcaccgtccacgtggctttggcctttctgaca
gccattggggacaagaaccacagggctatgctcgccctggagcacatgttcgctcctgtt
ctggacggtgctgtgtccactctgctgggtgtactgatgcttgcgggatccgaatttgac
ttcattgtcagatacttctttgccgtcctggccatcctcaccgtcttgggagttctcaac
ggactggttctgctgcctgtactcttatccttcttcggaccatgtcctgaggtgtctcca
gccaacggcctaaaccggctgcccactccttcgcctgagccgcccccaagcgtcgtccgg
tttgccgtgcctcctggtcacacgaacaatgggtctgattcctccgactccgagtacagc
tctcagaccacggtgtctggcatcagtgaggagctcaggcactatgaagcacagcagggc
accggaggtcctgcccaccaagtgattgtggaagccacagaaaaccccgtctttgcccgg
tccactgtggtgcatcctgactccagacatcagcctcccttgaactctcggcaacagccc
cacctggactctggctccctgtcccctggacggcaaggccagcagcctcgaagggatccc
cccagagaaggcttgcggccacccccctacagaccgcgcagagacgcttttgaaatttct
actgaagggcattctggccctagcaatagggaccgctcgggcccccatggggcccgttct
cacaaccctcggaacccaacgtccactgccatgggcagctctgtgcccagctactgccag
cctatcaccactgtgacggcttccgcttctgtaactgtcgctgtgcaccccccacctgga
cctgggcgcaacccccgagggggaccctgtccaggctacgagagctaccccgagactgat
cacggggtgttcgaggatccccatgtgccttttcatgtcaggtgtgagaggagggactcg
aaggtggaggttatagaactacaggacgtggagtgtgaggagaggccgtgggggagcagc
tccaactga

DBGET integrated database retrieval system