KEGG   Rattus norvegicus (rat): 89833Help
Entry
89833             CDS       T01003                                 

Gene name
Ftcd
Definition
(RefSeq) formimidoyltransferase cyclodeaminase
  KO
K13990  glutamate formiminotransferase / formiminotetrahydrofolate cyclodeaminase [EC:2.1.2.5 4.3.1.4]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00340  Histidine metabolism
rno00670  One carbon pool by folate
rno01100  Metabolic pathways
Module
rno_M00045  Histidine degradation, histidine => N-formiminoglutamate => glutamate
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    89833 (Ftcd)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    89833 (Ftcd)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    89833 (Ftcd)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    89833 (Ftcd)
Enzymes [BR:rno01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.5  glutamate formimidoyltransferase
     89833 (Ftcd)
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.4  formimidoyltetrahydrofolate cyclodeaminase
     89833 (Ftcd)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    89833 (Ftcd)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   89833 (Ftcd)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FTCD_N FTCD FTCD_C
Motif
Other DBs
NCBI-GeneID: 89833
NCBI-ProteinID: NP_446019
RGD: 70915
Ensembl: ENSRNOG00000001261
UniProt: O88618
Structure
PDB: 

Position
20p12
AA seq 541 aa AA seqDB search
MSQLVECVPNFSEGNNQEVIDAISQAISQTPGCVLLDVDAGPSTNRTVYTFVGQPECVVE
GALSAARTASQLIDMRKHKGEHPRMGALDVCPFIPVRGVSMDECVLCAKAFGQRLAEELN
VPVYLYGEAAQMPSRQTLPAIRAGEYEALPEKLKQAEWVPDFGPSSFVPSWGATVTGARK
FLIAFNINLLSTKEQAHRIALNLREQGRGKDQPGRLKKVQGIGWYLEEKNLAQVSTNLLD
FEVTALHTVYEEARREAQELNLPVVGSQLVGLVPLKALLDAAAFYCDKEKLFVLEEEHRI
RLVVNRLGLDSLAPFDPKERIIEYLVPDSGPEQSLLDASLRAFVREVGARSAAPGGGSVA
AAVAALGAALASMVGQMTYGRRQFDHLDSTMRRLIPPFHAASAQLTSLVDADARAFAACL
GAIKLPKNTPEERDRRTCALQEGLRQAVAVPLKLAETVSQLWPALQELAQCGNLSCLSDL
QVAAKALETGVFGAYFNVLINLKDMTDDVFKEKTRHRISSLLQEAKTQAALVLGSLEARK
E
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagttggtggaatgtgtccccaacttctcagaggggaacaaccaggaggtgatc
gatgccatttctcaagccatctcccagaccccaggttgtgtgctgttggacgttgatgct
ggaccctccaccaaccgcactgtctacacttttgtggggcagccggagtgtgtggtcgag
ggagccctcagtgctgcgcgaacagcctcacagctcatcgacatgaggaagcacaaggga
gagcaccctcgaatgggtgctctggatgtgtgtcccttcatcccggtgaggggcgtcagc
atggacgagtgtgtgctctgtgccaaggcatttgggcagcggctggcagaggaactgaat
gtaccagtgtacctctatggtgaggcggctcagatgcccagtcgtcagaccctgccagcc
atccgggctggagagtatgaggccctgcctgagaagctcaaacaggccgagtgggtgccc
gactttggccctagctcctttgtccccagttggggtgccactgtcacgggtgcacggaaa
ttcctcattgcgttcaatatcaatctgctaagcaccaaggaacaggcccaccgtatcgct
ctcaacctgcgggagcagggccgagggaaagaccagccgggacgtctgaaaaaggttcag
ggcatcggctggtacctagaagagaagaacctggctcaggtgtccaccaacctcctggat
tttgaggtcacggctctgcacacagtgtacgaggaggcccgccgagaggctcaggagctg
aatctcccagtggtgggctcacagctggtgggcctggtgcctctgaaggccttactggat
gccgcagccttctactgtgacaaggagaagctgtttgttctggaggaggagcaccggatt
cgactggtggtgaaccggctgggtctggattccctggcgcccttcgacccaaaggagcgg
atcatcgagtacctggtcccggatagtggaccagaacagagcctgctggacgcatcactg
cgtgcttttgttcgggaggtgggagcccgctctgctgccccaggaggcggttccgtagcc
gcagctgttgcagctctgggtgcagccctggcttctatggtgggccagatgacctatggc
cggcgccagtttgatcacctggattccacaatgcgacgcttgatcccacccttccatgca
gcctccgcccagctgacttcattggtggacgctgacgcgcgggcttttgctgcctgtttg
ggggcaataaagctgcccaagaatacgcctgaagagagggacaggcgcacatgtgctctg
caagaggggctgagacaggcggtcgctgtgccactgaaactggctgagacggtgtcccag
ctatggccggcgctgcaggagctggcccaatgtggcaacctctcttgcttgtctgacctg
caggtggcagccaaagccttggagacaggtgtgtttggtgcgtacttcaatgtgctcatc
aacctgaaggacatgacggatgatgtatttaaagagaagacacgccatcgaatctccagc
cttctgcaggaagccaagacccaggctgcgctggtgctgggtagcctagaagctcggaag
gagtga

DBGET integrated database retrieval system