KEGG   Rattus norvegicus (rat): 89841Help
Entry
89841             CDS       T01003                                 

Gene name
Pcyt2, ET
Definition
(RefSeq) phosphate cytidylyltransferase 2, ethanolamine
  KO
K00967  ethanolamine-phosphate cytidylyltransferase [EC:2.7.7.14]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00440  Phosphonate and phosphinate metabolism
rno00564  Glycerophospholipid metabolism
rno01100  Metabolic pathways
Module
rno_M00092  Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    89841 (Pcyt2)
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    89841 (Pcyt2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.14  ethanolamine-phosphate cytidylyltransferase
     89841 (Pcyt2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTP_transf_like FAD_syn DUF218
Motif
Other DBs
NCBI-GeneID: 89841
NCBI-ProteinID: NP_446020
RGD: 619970
Ensembl: ENSRNOG00000036684
UniProt: O88637
Position
10q32.3
AA seq 404 aa AA seqDB search
MIRNGHGAGGAAGLKGPGGQRTVRVWCDGCYDMVHYGHSNQLRQARAMGDYLIVGVHTDE
EIAKHKGPPVFTQEERYKMVQAIKWVDEVVPAAPYVTTLETLDKHNCDFCVHGNDITLTV
DGRDTYEEVKQAGRYRECKRTQGVSTTDLVGRMLLVTKAHHSSQEMSSEYREYADSFGKP
PHPTPAGDTLSSEVSSQCPGGQSPWTGVSQFLQTSQKIIQFASGKEPQPGETVIYVAGAF
DLFHIGHVDFLQEVHKLAKRPYVIAGLHFDQEVNRYKGKNYPIMNLHERTLSVLACRYVS
EVVIGAPYSVTAELLNHFKVDLVCHGKTEIVPDRDGSDPYEEPKRRGIFCQIDSGSDLTT
DLIVQRIIKNRLEYEARNQKKEAKELAFLEALRQQEAQPRGETD
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgatccggaacgggcacggggctggcggcgctgctgggctgaagggtccgggcggccag
cgcaccgtgcgggtgtggtgcgatggctgctatgacatggtgcattacggccactccaac
cagctacgccaggcgcgggccatgggggactacctcattgtgggcgtgcatactgacgag
gagattgccaagcataaggggcccccggtgtttacccaggaggagcggtacaagatggta
caggccatcaagtgggtggatgaagtggtaccggctgctccctacgtcaccacactggag
acactggacaagcacaactgtgacttctgcgttcatggcaatgacatcacgctgacagta
gatggccgagatacctacgaggaagtgaagcaggctgggaggtacagagagtgcaaacgc
acccagggtgtgtccaccacagacctcgtgggtcgcatgctgctggtgaccaaggcccac
catagcagccaggagatgtcctctgagtaccgggaatatgctgacagttttggcaagccc
cctcacccgacacctgccggggacacactttcctcagaagtctcctcccagtgccctggg
gggcagagcccctggacaggggtgtcccagttcctacagacatcccagaagatcatccag
tttgcttctgggaaggagccccagcccggggagacagtcatctatgtggctggtgccttt
gacctgttccacatcgggcacgtggacttcctacaggaggtgcacaagctagccaagagg
ccctacgtcatcgcgggcctacactttgaccaggaagtaaaccggtacaagggcaagaac
taccccatcatgaacctgcatgagcggactctcagtgtgctggcctgccggtatgtttca
gaagtggtgattggggcaccgtactccgtcacagcagagctcctgaatcatttcaaggtg
gacctggtgtgtcatgggaagacagaaattgtacccgacagggatgggtctgacccctac
gaggagcccaagagaagaggcattttctgtcagattgacagtggcagtgacctcactaca
gacctgattgtgcaaaggatcatcaagaacaggttggagtacgaagcacggaatcagaag
aaggaagccaaggaattagcctttttggaggccctgaggcagcaggaggcacagcccaga
ggggagactgactag

DBGET integrated database retrieval system