KEGG   Rattus norvegicus (rat): 93646
Entry
93646             CDS       T01003                                 

Gene name
Sec31a
Definition
(RefSeq) protein transport protein Sec31A
  KO
K14005  protein transport protein SEC31
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    93646 (Sec31a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    93646 (Sec31a)
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rno02044]
    93646 (Sec31a)
Membrane trafficking [BR:rno04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Coat protein complex II (COP-II)
    93646 (Sec31a)
Secretion system [BR:rno02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   93646 (Sec31a)
SSDB
Motif
Pfam: Sec16_C Prp18 SRA1
Other DBs
NCBI-GeneID: 93646
NCBI-ProteinID: NP_148981
RGD: 620233
Ensembl: ENSRNOG00000002251
UniProt: Q9Z2Q1
Position
14
AA seq 1249 aa
MKLKEIDRTAMQAWSPAQNHPIYLATGTSAQQLDATFSTNASLEIFELDLSDPSLDMKSC
ATFSSSHRYHKLIWGPHKMDSKGDVSGVLIAGGENGNIILYDPSKIIAGDKEVVIAQKDK
HTGPVRALDVNIFQTNLVASGANESEIYIWDLNNFATPMTPGAKTQPPEDISCIAWNRQV
QHILASASPSGRATVWDLRKNEPIIKVSDHSNRMHCSGLAWHPDVATQMVLASEDDRLPV
VQMWDLRFASSPLRVLENHARGILAIAWSMADPELLLSCGKDAKILCSNPNTGEVLYELP
TNTQWCFDIQWCPRNPAVLSAASFDGRIRVYSIMGGSIDGLRQKQVDKLSSSFGNLDPFG
TGQPLPPLQIPQQTSQHSIVLPLKKPPKWIRRPVGASFSFGGKLVTFENVTGQPQQGAEQ
PRRQPVFISQVVTEKDFLSRSEQLQHVVQSQGFISYCQKKIDASQTDFEKNVWSFLKVNF
EEDSRGKYLELLGYRREDLGEKIALALNRVDGSDVALKDSDRVAQSDGEESPAEEGQLLG
ERIKEEKQECDFLPSAGGGTFNISVSGDIDGLITRALLTGNFESAVDLCLHDNRMADAII
LAIAGGQELLAQTQKKYFAKSQSKITRLITAVVMKNWKEIVESCDLKNWREALAAVLTYA
KPDEFSALCDLLGARLESEGDSLLRTQACLCYICAGNVERLVACWTKAQDGSNPLSLQDL
IEKVVILRKAVQLTQALDTNTVGALLAEKMSQYANLLAAQGSIAAALAFLPDNTNQPDIV
QLRDRLCRAQGRSVPGQESSRSSYEGQPLPKGGPGPLAGHPQVSRVQSQQYYPQVRIAPT
VTTWSDRTPTALPSHPPAACPSDTQGGNPPPPGFIMHGNVVPNSPAPLPTSPGHMHSQPP
PYPQPQPYQPAQQYSFGTGGSAVYRPQQPVAPPASNAYPNAPYVSPVASYSGQPQMYTAQ
PASSPTSSSAPLPPPPSSGASFQHGGPGAPPSSSAYALPPGTTGTPPAASELPASQRTGP
QNGWNDPPALNRVPKKKKLPENFMPPVPITSPIMNPGGDPQPQGLQQQPSASGPRSSHAS
FPQPHLAGGQPFHGIQQPLAQTGMPPSFSKPNTEGAPGAPIGNTIQHVQALPTEKITKKP
IPDEHLILKTTFEDLIQRCLSSATDPQTKRKLDDASKRLECLYDKLRDQTLSPTIISGLH
SIARSIETRNYSEGLTVHTHIVSTSNFSETSAFMPVLKVVLSQASKLGV
NT seq 3750 nt   +upstreamnt  +downstreamnt
atgaagctaaaggagatagaccgcacggcgatgcaggcgtggagccctgcccagaaccac
cccatttacctggccacagggacatctgctcagcagttggacgcgacattcagtaccaac
gcttcccttgagatattcgagctcgacctttccgacccgtccttggatatgaagtcctgt
gctactttctcctcgtctcacaggtaccacaagctgatctggggacctcataaaatggat
tccaaaggagatgtttctggagttttgattgcaggtggagaaaatggaaacattattctc
tacgatccttctaaaattatagctggagacaaggaagttgtgattgcccaaaaggacaag
catactgggccagtgagagccttggatgtaaacatcttccagaccaatttggtggcctct
ggtgctaatgaatctgaaatctacatttgggatctaaacaattttgcaactccaatgacg
ccaggagctaaaacacagccaccagaagatatcagctgcatagcctggaacagacaggtc
cagcatatcttagcatcagccagtcccagtggccgggcaacggtctgggatctcaggaaa
aacgagcctattatcaaagtcagcgaccacagtaacaggatgcactgctctgggctggca
tggcaccctgatgtcgctactcagatggtccttgcttctgaggatgatcgattaccagtg
gtccagatgtgggatcttcgatttgcttcctctcccctccgggttctggaaaatcatgcc
agggggattttggcaattgcttggagcatggcagatcctgaattgttgttaagctgtgga
aaagatgctaagattctctgctctaaccctaacacgggagaggtattatatgaacttccc
accaacacacagtggtgctttgatatccagtggtgtcctcggaatcctgccgtcctgtct
gccgcttccttcgatggtcgcatccgtgtctactccatcatgggagggagcatagacggc
ttaaggcagaaacaagttgacaagctttcgtcgtcttttgggaatcttgatccgtttggc
acaggacagccgctccctccattacaaatcccacagcagacttcacagcacagcatcgtg
ctgcccctgaagaagccacccaagtggatccggagacctgtgggcgcctccttctcattc
ggagggaagttggtgactttcgagaacgttacagggcagcctcagcagggagctgagcag
ccacggcggcagcccgtgttcatcagtcaggtggtgacagaaaaggacttcctcagccgc
tcagagcagctacagcacgtcgtgcagtctcagggctttatcagttactgccagaaaaag
atcgatgcgtcccagactgacttcgagaagaatgtgtggtccttcttgaaggtaaacttt
gaggaggattctcgtgggaaataccttgagcttcttggatatagaagagaagatctggga
gagaagattgctttggccttgaacagagtggacggatccgatgtggctcttaaggactct
gaccgagtagcgcagagtgatggggaggagagccctgccgaggaagggcagctcctggga
gagcgcattaaagaggaaaaacaggagtgtgactttctgccctcggctggcggtgggacc
tttaacatctccgtcagtggggatattgatggtttaattacccgggctttgctgaccggc
aattttgagagcgcagttgacctttgtttacacgataaccgaatggctgatgccatcata
ttagccatcgcaggtgggcaggagctcttggctcaaacgcagaagaaatactttgcaaaa
tcccaaagcaagattaccaggcttatcactgcggtggtgatgaagaactggaaggagatt
gttgaatcctgtgatcttaaaaattggagagaggctttagctgcggtcctcacttatgct
aagccagatgagttctccgccctgtgtgatctcttgggagccaggcttgaaagtgaagga
gacagcctcctgcggactcaggcctgcctctgctatatctgtgccgggaatgtagagaga
ttagttgcttgttggaccaaagctcaagatggtagcaaccccttgtctctccaggatctg
attgagaaagttgtcatcctccgaaaagctgtacagctcacgcaagccctggacacgaac
actgtcggggctcttctggccgagaagatgagtcagtatgccaacttgttggcagcccag
ggcagtattgccgcggccttggcgtttctgcctgacaacaccaaccagccagatatcgtg
cagctgcgtgacagactctgcagagctcaaggcaggtctgtgccggggcaggagtcctct
aggagctcctacgaggggcagccgctgcccaagggcgggcccgggccgcttgctggccac
ccgcaggtgtccagagttcaaagtcagcaatattatccccaggttagaattgcccctact
gtcactacctggagtgacagaactcccactgccctccccagccatccacctgcagcctgt
ccctctgacacacagggagggaatcctccacctccaggtttcataatgcatggcaacgtt
gttccaaatagccctgccccactgccgacgtctccaggccacatgcacagccagccacca
ccttatccgcagccgcagccttaccagccagcccagcagtattccttcggaacagggggg
tcagcagtttatcgacctcaacagcctgttgctcctcctgcttctaacgcttaccctaac
gccccatacgtatctcctgtcgcttcctactccgggcagcctcagatgtacacagcacag
ccagcctcctcccctacctccagctctgctcctcttccccctcccccttcctctggagcg
tccttccagcatggcggaccaggagctccaccgtcatcttcagcttatgcactgcctcct
ggaacaacaggtacaccgcctgctgccagtgagctgcctgcgtcccagagaacaggtcct
cagaatggttggaatgatcctcccgctttgaacagagtaccgaagaagaagaagctgcct
gagaacttcatgcctcctgtccccattacgtcaccaatcatgaaccccgggggagatccc
cagccacaggggctgcagcaacagccttcagcttcagggccacggtcaagccacgcctcc
ttcccgcagccgcacctagccggcggccagcccttccacgggatccagcagcctcttgct
caaacaggcatgccaccgtctttctcgaagcccaacactgaaggggcccccggcgctccc
attgggaacaccatccagcatgtgcaggctctgccaacagaaaaaattaccaagaagcct
attccagacgagcacctcattctaaagactacgtttgaggaccttatccagcgctgcctc
tcctcagctacagacccccaaaccaagaggaagctggacgacgccagcaaacgcctggag
tgtctgtacgacaaacttagggaccagacactttctccaacaatcatcagcggtctccac
agcattgcgaggagcattgagacgaggaactactctgaagggttgaccgtccacactcac
atcgtcagcaccagcaacttcagtgagacctcagccttcatgccagtcctcaaggttgtg
ctcagccaggccagtaagctgggcgtctga

DBGET integrated database retrieval system