KEGG   Rattus norvegicus (rat): 94106
Entry
94106             CDS       T01003                                 

Gene name
Vegp2
Definition
(RefSeq) von Ebners gland protein 2
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: Lipocalin VDE
Other DBs
NCBI-GeneID: 94106
NCBI-ProteinID: NP_446026
RGD: 620384
Ensembl: ENSRNOG00000033020
UniProt: P41244
Position
3p13
AA seq 177 aa
MKALLLTFSLSLLAALQAQAFPTTEENQDVSGTWYLKAAAWDKEIPDKKFGSVSVTPMKI
KTLEGGNLQVKFTVLISGRCQEMSTVLEKTDEPGKYTAYSGKQVVYSIPSAVEDHYIFYY
EGKIHRHHFQIAKLVGRNPEINQEALEDFQNAVRAGGLNPDNIFIPKQSETCPLGSN
NT seq 534 nt   +upstreamnt  +downstreamnt
atgaaggccctgctcctgaccttcagcctcagcctcctggctgccctgcaggcccaggcc
ttccccaccacggaagagaatcaggatgtgtcaggaacgtggtatttgaaagctgcagca
tgggacaaggagattcctgacaagaagtttggatctgtgtctgtgactcccatgaaaatc
aagaccctggaagggggcaacctgcaagtgaagttcactgtcctgatttcaggacggtgc
caggagatgagcactgtcctagagaagacagatgaacctggcaaatacacagcctatagt
ggcaaacaggtagtctacagcataccatctgcagtggaggaccactatatcttctactat
gagggcaaaatacacagacatcatttccaaattgcaaaactcgtgggcagaaaccctgag
atcaaccaggaggccctggaagattttcagaatgctgtaagagctggaggcctcaaccca
gacaacatcttcatccccaagcagagtgaaacatgccctctaggaagcaattag

DBGET integrated database retrieval system