KEGG   Rattus norvegicus (rat): 94164
Entry
94164             CDS       T01003                                 

Gene name
Hbg1, Glnb2, Hbb-y, Hbe1
Definition
(RefSeq) hemoglobin subunit gamma 1
  KO
K13825  hemoglobin subunit epsilon
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    94164 (Hbg1)
SSDB
Motif
Pfam: Globin Glycogen_syn Kinocilin
Other DBs
NCBI-GeneID: 94164
NCBI-ProteinID: NP_742090
RGD: 620306
Ensembl: ENSRNOG00000030879
UniProt: O88754
Position
1q32
AA seq 147 aa
MVHFTAEEKAAIISIWEKVDLEKIGGETLGRLLIVYPWTQRFFDKFGNLSSALAIMGNPR
IRAHGKKVLTSLGSAVENMDNLKETFAHLSELHCDKLHVDPQNFKLLGNMLVIVLSTHFA
KEFTPEVQAAWQKLVMGVANALSHKYH
NT seq 444 nt   +upstreamnt  +downstreamnt
atggttcacttcacagctgaggagaaggctgctatcataagcatatgggaaaaagtggac
ttggaaaaaattggaggagaaaccctgggaaggctcctgattgtttacccatggactcag
agattctttgacaaatttggaaacctctcttctgctctggccatcatgggtaacccccgg
atcagagcccatggcaagaaagtgctgacgtctctaggttcggcagttgagaacatggac
aacctcaaggagacctttgctcatctgagtgagctacactgtgacaagcttcatgtggat
cctcagaacttcaagctcctgggcaacatgttggtgattgtcctttctactcattttgcc
aaggaattcaccccagaggtgcaggctgcctggcagaagctggtgatgggtgtggccaat
gctctgtcccacaagtaccattaa

DBGET integrated database retrieval system