KEGG   Rattus norvegicus (rat): 94165Help
Entry
94165             CDS       T01003                                 

Gene name
Cabin1, Cain
Definition
(RefSeq) calcineurin binding protein 1
  KO
K17613  calcineurin-binding protein cabin-1
Organism
rno  Rattus norvegicus (rat)
Brite
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     94165 (Cabin1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MEF2_binding TPR_2 TPR_8 TPR_1 TPR_11 FAT TPR_9
Motif
Other DBs
NCBI-GeneID: 94165
NCBI-ProteinID: NP_446027
RGD: 620263
Ensembl: ENSRNOG00000001237
UniProt: O88480 G3V650
Position
20p12
AA seq 2182 aa AA seqDB search
MIRIAALNASSTIEDDHEGSFKSHKIQTKEAQEAEAFALYHKALDLQKHDRFEESAKAYH
ELLEARLLREAVSSGDEKEGLKHPGLILKYSTYKNLAQLAAQREDLETAMEFYLEAVMLD
STDVNLWYKIGHVALRLIRLPLARHAFEEGLRCNPDHWPCLDNLITVLYTLSDYTTCLYF
ICKALEKDCRYSKGLVLKEKIFEEQPCLRKDSLRMFLKCDMSVHEVSVNAAETQAIVDEA
LGLRKKRQALIVREKEPDLKLVQPIPFFTWKCLGESLLAMYNHLTTCEPPRPSLGKRIDL
SDYQDPSQLLAPSVVVTPVSVVQPSPVCTNPTVAVAEPVLSYTSVTTTSFPLHSPGLLDT
GTPMGDVSGGDKSKKGVKRKKTLEESGETAKRRSARVRNTKCKKEEKVDFQGLLVKFLPS
RLRKLDPEEEDDPFNNYEVQSEAKLESFSNVGPHRLSFDSATFMESEKQDVHAFLMENLT
NGGVLELMMRYLKSMGHKFLLKWPPGLAEVVLSVYHSWRRHSTSLPNPLLRDCSNKHIKD
MMLMSLSCMELQLDQWLLTKGRSSTVSPRNCPAGVVTGRFGPDFPGTHCLGDLLQLSFAS
SQRDLFEDGWLEFVVRVYWLKARFLALQGDMEQALENYDICTEILQSSTALQAQAGAEQR
DIVIRLPNLHNDSIVSLEEIDKNLKSLERCQSLEEIQRLFEAGDYKAVVQLLRPTLCTSG
FDRAKHLEFMTSIPERPAQLLLLQDSLLRLEEHRQCFECSDVALNEAVQQMLNSSDSAAK
EEWAATVTQLLLGMEQALSSDSRGSILKESSSPTGLVRLTNNLIQVIDCSMAVQEEPKEP
YVSSVLPWIILHRIIWQEEDTFRSLCHQQQLQNPTEEGISEMPMLPSSLMLLNTAHEYLG
RRSWCCNSDGALLRFYVHVLQKELAASASEDTHPYKEELETALEQCFYCLYSFPSKKSKA
RYLEEHSAQQVDLTWEDALFMFEYFKPKTLPEFDSYKTSTVSADLANLLKRIATIVPRTE
KPALSMDKVSAYIEGTSAEVPCLPDGADPAPPVLNELYYLLADYHFKNKEQSKAIKFYMH
DICICPNRFDSWAGMALARASRIQDKLNSNELKSDGPIWRHATPVLNCFRRALEIDSSNL
SLWIEYGTMSYALHSFASRQLKQWRAELPPEVVQQMEDRRDSMLETARHCFTSAAHCEGD
GDEEEWLIHYMLGKVAEKQQQPPTVYLLHYRQAGHYLHEEAARYPKKIHYHNPPELAMEA
LEVYFRLHASILKLLGKPDSGVSAEVLVSFMKEAAEGPFARGEEKNTPKASEKEKACLVD
EDSHSSAGTLPGPGASLPSSSGPGLTSPPYTATPIDHDYVKCKKPRQQATPDDRSQDSTA
VALSDSSSTQDFFNEPTSLLDGSRKLLPEKRISGLSAQAGPSGKDLPGPTEERGKTEESL
ESTEAFRVVEPSVQKPVADSSASAYIPSKPAVSTPPPWDGKKRSDPLGEPVAFPQGLPAG
AEEQRQFLTEQCIASFCLCLSRFPQHYKSLYRLAFLYTYSKTHRNLQWARDVLLGSSIPW
QQLQHMPAQGLFCERNKTNFFNGIWRIPVDEIDRPGSFAWHMNRSIVLLLKVLAQLRDHS
TLLKVSSMLQRTPDQGKKYLRDADRQVLAQRAFILTVKVLEDTLSELAEGLEHPGSKACG
LSGARMTTDVSHKASPEDGQESLPHPKKLPLADGSGPGPEPGGKVGPLHQLPVATDTRDN
TEQGGEPKDKERPPVGPTEPMDTGETAARHPDLEPTPRLLPGRPPRDRGPESRSAELSLE
ELSISTRQQPAPLVPSPVTPTTAAPTTMGARAAGHPEEAPPRPNRKRKLLQDTESGKTLL
LDAYRVWQQGQKAMAYDLSRIEKIMSETYMLIKQVDEETALEQAVKFCQVHLGAAAQRQA
SGDAPTTPKHPKDSRENFFPATVAPSAPDTTAPDALQRPSDSHLKPGLAAAITCPPSASA
STPDPGIPQPHRPEAVPSRAPLSPDGEEVSGVTEGPSFLSQEPRHSHQMKMAATGPLAEQ
HCWPVEAACQTGAEPTFSQATSTKVPSSGSTQTPESHQGKTESSRAKSRLLPNMPKLVIP
SATTKFPPEITVTPPTPTLLSPKGSISEETKQKLKSAILSAQSAANVRKESLCQPALEVL
ETSSQESSLESETDEDDDFMDV
NT seq 6549 nt NT seq  +upstreamnt  +downstreamnt
atgattcgaattgcagccttaaatgccagctccacaattgaagatgaccatgaaggaagc
tttaaaagtcacaaaatccagacaaaggaggctcaggaagcagaagcctttgccctatac
cacaaggccctggatctacagaaacatgacaggtttgaggagtctgccaaggcctaccat
gaactcctggaggctcgcctgctgcgagaggcagtttcatccggagatgagaaggaaggg
ctgaagcaccctggactgatactgaaatattctacgtataagaacctggcccagctggca
gcccagcgggaggacctggagacagccatggagttttatttggaggccgtgatgctggat
tccacagacgtcaacctttggtacaagattggacatgtggccctgaggctcatccgactt
cccctggctcgccatgcttttgaggaagggctccggtgtaatcctgaccactggccctgc
ttggacaacctcatcactgttttgtacaccctcagcgattacacaacatgtctttacttc
atctgcaaagcactggagaaagactgccgctacagcaaaggcctggttctcaaggagaag
atttttgaagagcaaccttgtctccgaaaggactcactccgaatgttcctcaaatgtgac
atgtcagttcacgaggtgtcagtgaatgcagcagagacacaggccattgtagacgaggct
ctggggctgcggaagaagaggcaggcgttgatcgtgcgggaaaaggagccagacctgaaa
ctagtgcagcccatccctttcttcacgtggaagtgccttggagagagcttgcttgccatg
tacaatcacctcaccacgtgtgagcctcccaggcccagcctgggcaagaggattgacctg
tctgactaccaggatcccagccagctgctagccccctccgtcgtggttactcctgtcagt
gtggtccagccaagtcctgtttgcaccaatccaactgttgctgtggccgagcctgtgctc
tcctacacctctgtgaccacaaccagcttcccactgcacagtcctggcctgctggacacg
ggcactcctatgggtgatgtttccggaggagataaatctaaaaaaggggtgaagcgtaag
aagactttagaggaaagtggggagacagcaaagcggaggtctgcccgtgtccgcaacacc
aagtgcaaaaaagaagagaaggtggatttccaggggcttctggtaaagttcctgccgtcc
aggttaagaaaactggaccctgaggaggaagatgatccatttaacaactatgaagttcag
tcagaagccaaactggagagcttctcgaacgtgggacctcatcgactgtccttcgattca
gccacattcatggaatctgagaagcaggatgtgcatgcgttcctgatggagaacctgacc
aatgggggcgtcctggagctcatgatgcgctacctgaagagcatgggccacaagttcctg
ctgaagtggcccccaggcctggcggaggtcgtacttagcgtctaccacagctggaggagg
cacagtaccagcctgcccaacccattgctgagggactgcagcaacaagcacatcaaggac
atgatgctgatgtctctttcctgcatggagctccaactggaccagtggcttctgaccaaa
ggcagaagctccacggtgtctccccggaactgccctgctggtgtggtgacaggcaggttt
gggccagacttcccaggaacccactgcctgggtgacctcctgcagctgtcatttgcgtca
tctcagcgggatctgtttgaggacggctggctggagtttgtggtccgtgtttactggctg
aaggcacgtttcttggcactacagggcgatatggagcaagctttggagaactatgatatc
tgcacagagatactccagagctccacggctctccaagcccaggcaggggctgagcaaagg
gacattgtcatccggctgcccaacctgcacaatgactccattgtttctctggaggaaatt
gataagaacctgaagtctctggaaaggtgccagtccctggaggagattcagcggctgttt
gaggcgggcgactacaaggctgtggtgcagctgctccggcccactctgtgcaccagtggc
tttgaccgagccaaacacctggagtttatgacttccattcccgagaggccggcccagctg
cttctgctgcaggactctctgctccggctggaggagcacaggcagtgctttgaatgctct
gacgtggccctcaatgaagctgtccagcagatgctgaactcgagtgactctgcggccaag
gaggagtgggcggccacagtgacgcagctgctgctaggcatggagcaggcactgtcatca
gacagcaggggcagcatcctgaaggagtcctcctctcccacgggccttgtccggctcacc
aacaacctcattcaggtcatcgactgcagcatggctgtgcaggaggagcccaaggagccc
tatgtctcctccgtgctgccctggatcatcctccacaggatcatctggcaggaggaagac
actttccggtctctgtgccaccagcagcagctccagaacccaacggaagaagggatctcg
gagatgcccatgctcccatcttccctcatgctgctcaacacagcacatgagtacctgggc
aggaggtcctggtgctgcaattcagatggagcgctgctgcgattctatgtgcacgttctc
caaaaggagcttgctgcgtctgcctctgaggacactcacccctacaaggaggagctggag
accgccttggagcagtgtttctactgcctctacagcttccccagcaagaagagcaaggcc
aggtacctggaggagcactcagcccagcaggtggacctcacctgggaggacgccctgttc
atgtttgagtacttcaagcccaagaccctccctgagtttgacagctacaagaccagcacc
gtctccgcggacttggcaaacctgttgaaaagaatcgccaccattgtgccgcgcacagag
aagcccgccctgagcatggacaaagtctctgcctacattgagggaacctcagcggaggtg
ccctgccttcctgacggggcagaccccgcccctccagtgctgaatgagctctactacctc
ctggctgactatcacttcaaaaacaaagagcagtccaaagccatcaagttctacatgcat
gacatttgcatctgccctaacaggtttgattcctgggcaggcatggctctggcccgggcc
agccgaattcaggacaagctgaactcaaatgagctgaagagtgatggacccatctggaga
catgccacacctgttctgaactgcttccggagggcccttgagattgacagctctaacttg
tccttgtggattgagtatggcaccatgtcctatgccttgcactcattcgcgtcccgtcag
ctgaagcagtggcgagccgagctgcctcctgaggttgtgcagcagatggaggatcggcga
gacagcatgctggagacagccaggcactgtttcacgtctgcagcccactgcgagggtgat
ggcgatgaggaggagtggctcattcactacatgctgggcaaagtggccgagaagcagcag
cagccgccgaccgtgtacctgctgcactaccgccaggcgggccactacttacacgaggag
gccgcccgctaccctaagaagattcactaccacaacccgcccgagctggccatggaagcc
ctggaggtgtacttccggctccatgcgtccatcctgaagctcctgggcaaacctgactct
ggggttagcgcagaggtcctggtcagctttatgaaggaagcagcagaaggaccttttgcc
aggggcgaggagaagaatacacctaaagcttcagaaaaggagaaggcctgcctggtggat
gaggactcccactcttcagctgggacactgccgggccccggagcctcccttccctcctcc
tctggcccaggtctgacatccccaccttacacagccactccgattgaccacgattacgtc
aaatgtaaaaaaccccgtcagcaggcgacgccggacgaccgaagccaggacagcacagct
gtggcactgtcagactccagctcaacacaggacttctttaatgagcccacaagtttgctg
gacggttctcgaaagctccttccagagaagaggatctctgggctcagtgctcaagcagga
ccaagtggtaaagaccttccagggcccacagaggaaagaggaaaaacggaggagtctttg
gagagcacagaggccttccgggttgtagaaccaagcgtccagaagcctgtggcagattcc
tcggcctctgcttacatccccagcaagcccgcagtgtccacgccccctccgtgggatggg
aagaagaggagtgaccccctaggggagccagtggctttccctcaggggctgccagcaggt
gctgaggaacagcgccagttcctcacagagcagtgcatcgcctccttctgcctgtgcttg
agtcgcttcccacagcactacaagagtctctaccggctggcctttctctacacctacagc
aagactcaccggaacctccagtgggcccgtgatgtgttgctaggcagcagtatcccatgg
caacaactgcagcacatgccggcacaggggctcttctgcgagaggaacaagaccaatttc
ttcaacggcatctggcggatccccgtggatgagattgaccggcccggcagcttcgcctgg
cacatgaaccgctccatcgtgctgctactcaaggttctagcccagctccgggaccacagc
accctgttgaaggtgtcctccatgctgcagcggacaccagaccagggcaagaaatatctg
cgagatgctgaccgccaggtgctggcacagcgcgccttcatcctcactgtgaaggtgctg
gaggacacactgagtgagcttgcagaggggttagagcacccaggatccaaggcctgtggc
ctctctggagccaggatgaccaccgatgtctcacacaaagccagtcccgaggatggccag
gaaagcctcccacaccccaagaagctacctctagctgatggctcaggaccagggcctgag
ccagggggcaaagtgggccctctccaccaattgccagtggccacagacacaagggacaac
acagagcagggtggggagccgaaagacaaagagcgtcccccggtggggcccacagaaccc
atggacaccggcgagactgctgctcgccacccagacttggaaccgacgccacgtctgttg
ccaggccgccccccaagggaccggggtcccgagagccgctctgctgagctttccctggag
gagctgagcatcagcacccggcagcagcctgccccacttgtaccatccccagtaaccccc
accacagctgctcccactaccatgggggccagggcagcggggcaccccgaggaggcaccg
ccaaggcctaatcgaaagaggaaactcctgcaggacacagagtctggcaagacgctcctt
ttggacgcctaccgtgtgtggcagcagggccagaaggccatggcctatgacctgagccgc
atcgagaagatcatgtcggagacttacatgctcatcaagcaggtggacgaggagactgca
ctggagcaggctgtgaagttctgtcaggtccacctcggggctgctgcccagagacaggcc
tcaggagatgcacccactacccccaagcaccccaaggacagccgagagaatttcttccct
gcaacagtggccccctcagcacctgacaccacagcacctgacgctctccagcggcccagt
gactcccacctcaagcctgggttggctgctgccatcacctgccctccctcagcatcagcc
tctaccccagaccctggaattccccagccacacaggccagaggctgtgcccagcagggcc
cctctgagtcctgatggagaagaggtgtcaggagtgacagagggtcccagctttctatcc
caagaaccacggcacagtcaccagatgaaaatggctgccactggtcccctggccgagcag
cactgctggccagtggaggctgcttgccagacaggtgccgagcccaccttcagccaagcc
accagcaccaaggtccccagcagtggaagtacccagacacctgagagccatcaaggcaaa
actgagtccagcagagccaagtcccgcctcctgcccaacatgccaaagctggtgatcccc
tcggccaccaccaagttcccccctgagatcaccgtcacaccacctacccccaccctgctc
tcccccaaaggcagcatctcagaggagaccaagcagaagctgaagtctgccatcctgtct
gcccaatctgccgccaatgtgaggaaggagagcctgtgccagccagccctggaggttctg
gagacatccagccaggagtcctcattggagagtgagacagacgaggacgatgactttatg
gacgtatga

DBGET integrated database retrieval system