KEGG   Rattus norvegicus (rat): 94167
Entry
94167             CDS       T01003                                 

Gene name
Prdx6
Definition
(RefSeq) peroxiredoxin-6
  KO
K11188  peroxiredoxin 6 [EC:1.11.1.7 1.11.1.27 3.1.1.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    94167 (Prdx6)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.7  peroxidase
     94167 (Prdx6)
    1.11.1.27  glutathione-dependent peroxiredoxin
     94167 (Prdx6)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.-  
     94167 (Prdx6)
SSDB
Motif
Pfam: AhpC-TSA 1-cysPrx_C Redoxin
Other DBs
NCBI-GeneID: 94167
NCBI-ProteinID: NP_446028
RGD: 71005
Ensembl: ENSRNOG00000002896
Vega: OTTRNOG00000000189
UniProt: O35244
Position
13
AA seq 224 aa
MPGGLLLGDEAPNFEANTTIGHIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPE
FAKRNVKLIALSIDSVEDHFAWSKDINAYNGAAPTEKLPFPIIDDKDRDLAILLGMLDPA
EKDEKGMPVTARVVFIFGPDKKLKLSILYPATTGRNFDEILRVVDSLQLTASNPVATPVD
WKKGESVMVLPTLPEEEAKQLFPKGVFTKELPSGKKYLRYTPQP
NT seq 675 nt   +upstreamnt  +downstreamnt
atgcccggagggctgcttctcggggacgaagcccccaactttgaggccaataccaccatc
ggccacatccgcttccacgatttcctaggagattcatggggcattctcttttcccaccca
cgggactttaccccagtgtgcaccacagaacttggcagagctgcaaagctggcgccagag
tttgccaagaggaatgttaagttgattgctctttcaatagactctgttgaggaccatttt
gcctggagcaaggacatcaatgcttacaatggtgcagcacccacagaaaagctaccattt
cccatcatcgacgataaggacagggaccttgccatcctgttgggcatgttggatccagca
gagaaggatgaaaaaggcatgcccgtgacagcccgtgtggtattcatttttggccctgac
aagaaactaaaactgtccatcctctacccagccaccacgggcagaaactttgatgagatt
ctcagagtggttgactccctccagctgacagcatcaaatccagttgccactccagttgac
tggaagaagggagagagtgtgatggtccttcccaccctccctgaagaggaagccaaacaa
cttttccctaaaggagtcttcaccaaagagctcccatctggcaagaaatacctccgttat
acgccccagccttaa

DBGET integrated database retrieval system