KEGG   Rattus norvegicus (rat): 94193Help
Entry
94193             CDS       T01003                                 

Gene name
Madd
Definition
(RefSeq) MAP-kinase activating death domain
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: DENN uDENN
Motif
Other DBs
NCBI-GeneID: 94193
NCBI-ProteinID: NP_446037
RGD: 619922
Ensembl: ENSRNOG00000012568
UniProt: O08873
Position
3q24
AA seq 1602 aa AA seqDB search
MVQKKFCPRLLDYLVIVGARHPSSDSVAQTPELLRRYPLEDHPEFPLPPDVVFFCQPEGC
LSVRQRRMSLRDDTSFVFTLTDKDTGVTRYGICVNFYRSFQKRMPKEKAEGGAGPRGKEG
AHAPCASEEAATESSESGSTLQPPSADSTPDVNQSPRGKRRAKAGNRSRNSTLTSLCVLS
HYPFFSTFRECLYTLKRLVDCCSERLLGKKPGIPRGVQRDTMWRIFTGSLLVEEKSSALL
HDLREIEAWIYRLLRSPVPVSGQKRVDIEVLPQEVQQALTFALPDPSRFTLVDFPLHLPL
ELLGVDACLQVLTCILLEHKVVLQSRDYNALSMSVMAFVAMIYPLEYMFPVIPLLPTCMA
SAEQLLLAPTPYIIGVPASFFLYKLDFKMPDDVWLVDLDSNRVIAPTNAEVLPILPEPES
LELKKHLKQALASMSLNTQPILNLEKFHEGQETPLLLGRFSNDLQSTPSTEFNPLIYGND
VDSVDVATRVAMVRFFNSANVLQGFQMHTRTLRLFPRPVVAFQAGSFLASRPRQTPFAEK
LARTQAVEYFGEWILNPSNYAFQRIHNNTFDPALIGDKPKWYAHQLQPIHYRVYDSNSQL
AEALSVPPERDSESDPTDDSGSDSMDYDDSSSSYSSLGDFVSEMMKCDINGDTPNVDPLT
HAALGDASEVEIDELQPQKEGEEPGPDSENSQENLPLRSSSSTTASSSPSTIVHGAHSEP
ADSTEVGDKAATGISKPLPPVPPSICKSTVDRRQTETGEGSVCQRTYDHPYFEPQYGSPA
EEDDDEQGESYTPRFSQHASGSRAQKLLRPNSLKLASDSDAESDSRASSPNSTVSNNSTE
GFGGIMSFASSLYRNHSTSFSLSNLTLPTKGAREKTTPFPSLKGNRRALVDQKSSVIKHS
PTVKREPPSPQGRSSNSSENQQFLKEVVHSVLDGQGVGWLNMKKVRRLLESEQLRVFVLS
KLSRAVQSEDDARQDVIQDVEISRKVYKGMLDLLKCTVLSLEQSYAHAGLGGMASIFGLL
EIAQTHYYSKEPDKRKRSPTENVNTPVGKDPGLAGRGDPKAMAQLRVPQLGPRAPSATGR
GPKELDTRSLKEENFVASVGPEVIKPVFDLGETEEKKSQISADSGVSLASASQRTDQDSV
IGVSPAVMIRSSSQDSEVSNSSGETLGADSDLSSNAGDGPGGEGSAHLASSRATLSDSEI
ETNSATSTIFGKAHSLKPKEKPASSPVRSSEDVSQRVYLYEGLLGRDKGSMWDQLEDAAM
ETFSISKERSTLWDQMQFWEDAFLDAVMLEREGMGMDQGPQEMIDRYLSLGEHDRKRLED
DEDRLLATLLHNLISYMLLMKVNKNDIRKKVRRLMGKSHVGLVYSQQINEVLDQLTNLNG
RDLSIRSSGSRHMKKQTFVVHAGTDTNGDIFFMEVCDDCVVLRSNIGTVYERWWYEKLIN
MTYCPKTKVLCLWRRNGSETQLNKFYTKKCRELYYCVKDSMERAAARQQSIKPGPELGGE
FPVQDMKTGEGGLLQVTLEGINLKFMHNQVFIELNHIKKCNTVRGVFVLEEFVPEIKEVV
SHKYKTPMAHEICYSVLCLFSYVAAVRSSEEDLRTPPRPVSS
NT seq 4809 nt NT seq  +upstreamnt  +downstreamnt
atggtgcaaaagaagttctgccctcggttacttgactatctagtgatcgtaggggccagg
catccaagcagtgacagtgtggctcagactcctgaacttctgcggaggtacccactagag
gaccacccggagtttcccctgcccccagatgtggtgttcttctgccagccagagggatgt
ctgagcgtgcggcaacggcgcatgagcctccgagatgatacctcttttgtcttcacccta
accgataaggacactggagtcacccgttatggcatctgtgtcaacttctaccgttccttt
caaaagcgaatgccaaaggaaaaggcggaaggcggagcaggaccccgtgggaaggaagga
gctcatgccccctgtgcctcagaagaggccgccaccgagagctcagagagtggctcaacc
ttgcagcctcctagtgctgactccactcctgacgtaaaccagtctcctcggggcaaacgt
agggcaaaagcaggcaaccgctcccgaaacagtaccctgacatccctgtgtgtgcttagc
cactaccctttcttctctaccttcagagagtgtctgtatactctcaaacgtctggtagac
tgctgtagtgaacggctcctaggcaagaaaccgggcatccctcgaggtgtacaaagggac
accatgtggcgaatctttactggatcactgctagtggaggagaagtccagtgcccttctg
catgaccttcgagagatcgaggcctggatctatcggttgctacgctccccggtgcctgtc
tctgggcagaagcgagtggacattgaggtcctaccccaggaagtgcagcaggccctgaca
tttgctcttccagatccatcccggttcaccctagtagatttccctcttcaccttcccttg
gaacttctgggtgtagatgcttgtcttcaggtgctaacctgcatcctgttggagcacaag
gtggtgctacagtctcgagactacaacgcactctccatgtctgtgatggcgtttgtggca
atgatctaccccctggagtacatgttccctgtcatcccgctgcttcccacctgcatggct
tcggcagagcagctactcttggctccaaccccatatatcattggagtccctgccagcttt
ttcctctataagctagacttcaaaatgcctgatgacgtgtggctggtggatctggacagc
aacagggtgattgcccccaccaatgcagaagtgctacccatcctgccagaaccggaatca
ttagagctgaaaaaacacttaaagcaggctctagccagcatgagtctcaacacccagccc
attcttaatctggagaaattccatgagggccaggagacaccacttctcttgggaaggttt
tctaatgaccttcagtctacaccttccactgaattcaacccactcatttatggcaatgat
gtagattcagtcgatgttgcaacgagagtggccatggttcgtttcttcaactctgctaac
gtgctgcagggctttcagatgcacacacgtaccctgcgactcttcccccggcccgtggtt
gccttccaagctggctcctttctggcctcacgcccccggcagaccccctttgctgagaaa
ctggccaggactcaagccgtggagtactttggagaatggatcctgaacccttctaactat
gccttccagcggattcacaacaatacgtttgatccagccctcattggtgacaagcctaag
tggtacgctcaccagctgcagcccattcactatcgagtctatgacagcaattctcagctg
gctgaggccctgagtgtgccaccggagcgtgattctgagtctgaccccactgatgacagt
ggcagtgacagcatggactatgatgactcaagctcttcttactcctccctgggggacttc
gtcagtgaaatgatgaagtgtgacatcaatggcgacactcccaatgtggatcctctgacg
catgcggccctgggagacgccagtgaagtggagattgatgagctgcagccccagaaggag
ggagaggagcctggcccagacagtgagaactctcaggagaaccttcccctgcgctccagc
tccagcaccactgccagcagtagccctagcaccatcgtccacggcgcccactctgaacct
gctgattctacagaggtgggagataaggcagcaacaggcatctccaagcccctccctcct
gtgcctcccagcatttgcaaatctactgtggacaggagacagacagagactggagagggg
tcagtgtgccagcgaacctacgaccatccatattttgagccccaatatggctcccccgct
gaggaagatgatgacgagcagggagagagctacacgccccggttcagccaacatgccagt
ggcagtcgggctcaaaagctgctgcggcccaacagcttgaagctggccagtgactcagac
gcagagtcagactcccgagcaagctctcccaactccaccgtctctaacaacagcaccgag
ggcttcgggggcatcatgtcttttgctagcagcctgtatcggaaccatagtacaagcttc
agcctttcaaacctcacactgcccaccaaaggtgcccgagagaagactacaccattcccc
agcctgaaaggaaacaggagggccttagtggaccagaaatcatctgtcattaaacacagc
ccaactgtgaaaagagaacctccatcaccgcagggccggtccagcaattctagcgagaac
caacagttcctgaaggaggtggtccacagtgtgctggatggccagggagtcggctggctc
aacatgaaaaaggtgcgccggctgctggagagtgagcagctccgagtctttgtactgagc
aagctgagtcgtgcagtgcagtcagaggatgatgcccgacaggatgtcatccaggatgtg
gagatcagtcggaaggtgtacaagggaatgctagacctcctcaagtgcacagtcctcagc
ctcgagcagtcctatgcccatgctggtctgggtggcatggccagcatctttgggcttttg
gagattgcccagacccattactatagtaaagaaccagacaaacgcaagagaagtccaaca
gagaatgtaaataccccagttggcaaggatcctggtctggctgggcggggggacccaaag
gcaatggctcagctaagggtccctcagctgggtcctcgggcaccaagtgctacaggaagg
ggtcctaaagaactggacaccagaagtttaaaggaagagaattttgtagcgtctgtggga
ccagaggtcatcaagcctgtctttgacctgggtgagactgaggagaaaaagtcccagatc
agcgcagacagtggtgtgagcctggcatctgcttcccagaggactgatcaagactctgtc
atcggtgtgagtccagctgttatgatccgaagctcaagtcaggattctgaagtgagtaac
agttcaggagagaccctcggagcagacagtgacctgagcagcaatgcaggtgatgggcca
ggaggcgaaggcagtgcccacttggcaagttctcgggctactctgtctgacagtgaaatt
gaaaccaattctgctacaagcaccatctttggtaaagcccatagcttgaagccaaaggag
aagccggctagtagtccagttcgctcttccgaagatgtaagccagcgagtctatctctat
gagggactactaggaagggacaaaggatccatgtgggaccagttagaggatgctgctatg
gagaccttttctataagcaaagagcggtctactttatgggaccaaatgcagttctgggaa
gatgcgttcctagatgctgtgatgttggaaagagaaggaatgggtatggaccagggccct
caggaaatgatcgacaggtacctgtccctaggagagcatgaccggaagcgcctggaggat
gatgaagatcgcttactggccacactcttacacaacctcatatcctatatgctcctgatg
aaggtgaacaagaacgacatcaggaagaaagtacggcgcctaatgggaaagtcccacgtt
gggctggtgtacagtcaacaaatcaatgaggtgctcgatcagctgaccaacctgaatggg
cgtgatctctccatccgatccagtggcagcaggcacatgaagaagcagacgttcgttgtg
cacgcagggacggacacaaatggagatatctttttcatggaagtgtgtgacgactgtgtg
gtcttacgtagtaacatcgggacagtgtacgagcgctggtggtatgagaagcttatcaac
atgacctactgtcccaagaccaaggtcctgtgcttatggcgtagaaatggctctgagacg
cagctcaacaagttctataccaagaagtgtcgggagctgtactactgtgtgaaggacagc
atggagcgtgcggctgcccggcaacaaagcatcaaacccgggcctgaactaggtggtgag
ttccctgtgcaggacatgaagactggagagggcggcttgcttcaggtcaccctggaaggg
atcaatctcaagttcatgcataaccaggttttcatagagctgaatcacattaaaaagtgc
aatacagttcgaggcgtctttgtcctggaagaatttgttcctgaaattaaagaagtggtg
agccacaagtacaagactccaatggcccacgagatctgctattctgtgttgtgtctcttc
tcgtatgtggccgcagttcgtagcagtgaagaagacctccgaaccccacctcggcctgtc
tctagctga

DBGET integrated database retrieval system