KEGG   Rattus norvegicus (rat): 94195Help
Entry
94195             CDS       T01003                                 

Gene name
S100a9, Mrp14
Definition
(RefSeq) S100 calcium binding protein A9
  KO
K21128  protein S100-A9
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    94195 (S100a9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: S_100 EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_4 Pox_D5 EF-hand_8
Motif
Other DBs
NCBI-GeneID: 94195
NCBI-ProteinID: NP_446039
RGD: 620267
Ensembl: ENSRNOG00000011483
UniProt: P50116
Position
2q34
AA seq 113 aa AA seqDB search
MAAKTGSQLERSISTIINVFHQYSRKYGHPDTLNKAEFKEMVNKDLPNFLKREKRNENLL
RDIMEDLDTNQDNQLSFEECMMLMGKLIFACHEKLHENNPRGHDHRHGKGCGK
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atggctgccaaaacaggatctcagctggagcgcagcataagcaccatcatcaatgttttc
catcagtactctaggaagtatggacatcctgacaccctgaacaaggcggaattcaaagaa
atggtgaataaggacttgccaaattttctgaagagggagaaaagaaatgaaaatctccta
agagacatcatggaggacctggacacaaaccaggacaatcaactgtcctttgaggagtgt
atgatgctgatgggaaagttgatctttgcctgtcatgagaagctgcatgagaacaaccca
cgtgggcatgaccacaggcacggcaaaggctgtgggaagtaa

DBGET integrated database retrieval system