KEGG   Rattus norvegicus (rat): 94195
Entry
94195             CDS       T01003                                 

Gene name
S100a9
Definition
(RefSeq) protein S100-A9
  KO
K21128  protein S100-A9
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    94195 (S100a9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    94195 (S100a9)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 EF-hand domain-containing proteins
  S100 proteins
   94195 (S100a9)
SSDB
Motif
Pfam: S_100 EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_4 EF-hand_6 EF-hand_8 Pox_D5
Other DBs
NCBI-GeneID: 94195
NCBI-ProteinID: NP_446039
RGD: 620267
Ensembl: ENSRNOG00000011483
UniProt: P50116
Position
2
AA seq 113 aa
MAAKTGSQLERSISTIINVFHQYSRKYGHPDTLNKAEFKEMVNKDLPNFLKREKRNENLL
RDIMEDLDTNQDNQLSFEECMMLMGKLIFACHEKLHENNPRGHDHSHGKGCGK
NT seq 342 nt   +upstreamnt  +downstreamnt
atggctgccaaaacaggatctcagctggagcgcagcataagcaccatcatcaatgttttc
catcagtactctaggaagtatggacatcctgacaccctgaacaaggcggaattcaaagaa
atggtgaataaggacttgccaaattttctgaagagggagaaaagaaatgaaaatctccta
agagacatcatggaggacctggacacaaaccaggacaatcaactgtcctttgaggagtgt
atgatgctgatgggaaagttgatctttgcctgtcatgagaagctgcatgagaacaaccca
cgtgggcatgaccacagccacggcaaaggctgtgggaagtaa

DBGET integrated database retrieval system