KEGG   Rattus norvegicus (rat): 94198
Entry
94198             CDS       T01003                                 

Gene name
Psmb1
Definition
(RefSeq) proteasome subunit beta 1
  KO
K02732  20S proteasome subunit beta 6 [EC:3.4.25.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03050  Proteasome
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    94198 (Psmb1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    94198 (Psmb1)
   05012 Parkinson disease
    94198 (Psmb1)
   05014 Amyotrophic lateral sclerosis
    94198 (Psmb1)
   05016 Huntington disease
    94198 (Psmb1)
   05017 Spinocerebellar ataxia
    94198 (Psmb1)
   05020 Prion disease
    94198 (Psmb1)
   05022 Pathways of neurodegeneration - multiple diseases
    94198 (Psmb1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    94198 (Psmb1)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:rno03051]
    94198 (Psmb1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     94198 (Psmb1)
Peptidases and inhibitors [BR:rno01002]
 Threonine peptidases
  Family T1: proteasome family
   94198 (Psmb1)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    94198 (Psmb1)
SSDB
Motif
Pfam: Proteasome Cytochrom_C1
Other DBs
NCBI-GeneID: 94198
NCBI-ProteinID: NP_446042
RGD: 621092
Ensembl: ENSRNOG00000001488
UniProt: P18421
Structure
PDB: 
6EPF 6EPC 6EPE 6EPD

Position
1q12
AA seq 240 aa
MLSTAAYRDPDRELVMGPQGSAGPVQMRFSPYAFNGGTVLAIAGEDFSIVASDTRLSEGF
SIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLS
TILYSRRFFPYYVYNIIEGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQV
GFKNMQNVEHVPLTLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIREETVPLRKD
NT seq 723 nt   +upstreamnt  +downstreamnt
atgctttccactgccgcttaccgggacccggaccgagagctggtaatggggcctcagggc
tccgccggccctgtgcagatgcgtttctcgccttatgccttcaacggaggtactgtattg
gcaattgctggagaagatttttccatcgttgcttcagacactcggttgagtgaagggttt
tcaattcatacccgagatagccccaaatgttacaaactaacagacaaaacagtaattggc
tgcagtggctttcatggagattgtctcaccttgacaaagattattgaagcaagattaaag
atgtacaagcattccaataacaaggccatgacaacaggggcgattgctgcaatgctgtct
accatcctgtactcacggcgtttcttcccttactatgtctacaacatcattgagggactt
gatgaagaaggaaagggagccgtgtacagctttgacccagtaggctcttaccagagagac
tctttcaaagccggaggctcagcaagtgccatgctgcagccgctgctcgacaaccaggtt
ggcttcaaaaatatgcagaatgtggagcatgtccccctgactctggacagagccatgagg
ctggtgaaagacgtcttcatttctgcagccgagagggatgtgtacactggagacgccctc
aggatctgcatcgtgaccaaagagggcatcagggaggagactgttccccttcggaaagac
tga

DBGET integrated database retrieval system