KEGG   Rattus norvegicus (rat): 94203Help
Entry
94203             CDS       T01003                                 

Gene name
Pgf, Plgf
Definition
(RefSeq) placental growth factor
  KO
K16859  placenta growth factor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    94203 (Pgf)
   04015 Rap1 signaling pathway
    94203 (Pgf)
   04010 MAPK signaling pathway
    94203 (Pgf)
   04151 PI3K-Akt signaling pathway
    94203 (Pgf)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    94203 (Pgf)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    94203 (Pgf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    94203 (Pgf)
Cytokines and growth factors [BR:rno04052]
 Growth factors
  Growth factors (RTK binding)
   94203 (Pgf)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDGF YqzE
Motif
Other DBs
NCBI-GeneID: 94203
NCBI-ProteinID: NP_446047
RGD: 619850
Ensembl: ENSRNOG00000005650
UniProt: Q63434
Position
6q31
AA seq 158 aa AA seqDB search
MLAMKLFTCFLQVLAGLAVHSQGALSAGNNSTEMEVVPFNEVWGRSYCRPMEKLVYIADE
HPNEVSHIFSPSCVLLSRCSGCCGDEGLHCVALKTANITMQILKIPPNRDPHSYVEMTFS
QDVLCECRPILETTKAERRKTKGKRKQSKTPQTEEPHL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgctggccatgaagctgttcacttgcttcttgcaggtcctagctgggttggctgtgcac
tcccagggggccctgtctgctgggaacaactcaacagaaatggaagtggtgcctttcaat
gaagtgtggggccgcagctactgccggccaatggagaagctggtgtacattgcagatgaa
caccctaatgaagtgtctcatatattcagtccgtcatgtgtccttctgagtcgctgtagt
ggctgctgtggtgacgagggtctgcactgtgtggcgctaaagacagccaacatcactatg
cagatcttaaagattccccccaatcgggatccacattcctacgtggagatgacattctct
caggatgtgctctgcgaatgcaggcctattctggagacgacaaaggcagaaaggaggaaa
accaaggggaagaggaagcaaagcaaaaccccacagactgaggaaccccacctgtga

DBGET integrated database retrieval system