KEGG   Rattus norvegicus (rat): 94271Help
Entry
94271             CDS       T01003                                 

Gene name
Atp5j
Definition
(RefSeq) ATP synthase, H+ transporting, mitochondrial Fo complex, subunit F6
  KO
K02131  F-type H+-transporting ATPase subunit 6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05016  Huntington disease
Module
rno_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    94271 (Atp5j)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    94271 (Atp5j)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    94271 (Atp5j)
   05012 Parkinson disease
    94271 (Atp5j)
   05016 Huntington disease
    94271 (Atp5j)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-synt_F6 RICH
Motif
Other DBs
NCBI-GeneID: 94271
NCBI-ProteinID: NP_446054
RGD: 621376
Ensembl: ENSRNOG00000001551
UniProt: P21571
Position
11q11
AA seq 108 aa AA seqDB search
MTVQRIFRLSSVLRSAVSVHLRRNIGVTAVAFNKELDPVQKLFLDKIREYKAKRLASGGP
VDTGPEYQQEVDRELFKLKQMYGKGEMDKFPTFNFEDPKFEVLDKPQS
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgactgttcagaggatcttcaggctctcctctgtccttcggtcagcagtctctgtgcat
ttgaggaggaacattggtgttacagctgtggcgtttaataaggaacttgatcctgtacag
aaactcttcttggacaagataagagagtacaaagcaaagcgactggcgtctggaggacct
gttgatactggcccagaatatcagcaagaggtggacagagagctttttaagcttaaacaa
atgtatggtaaaggagagatggataagtttcctaccttcaattttgaggatcccaaattt
gaagtcctcgacaaaccccagtcctga

DBGET integrated database retrieval system