KEGG   Rattus norvegicus (rat): 94272
Entry
94272             CDS       T01003                                 

Gene name
Clic5
Definition
(RefSeq) chloride intracellular channel 5
  KO
K05025  chloride intracellular channel protein 5
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    94272 (Clic5)
Ion channels [BR:rno04040]
 Chloride channels
  Chloride channel, intracellular (CLIC)
   94272 (Clic5)
SSDB
Motif
Pfam: GST_C_2 GST_N_2 GST_N_3 GST_C GST_C_3 GST_C_5
Other DBs
NCBI-GeneID: 94272
NCBI-ProteinID: NP_446055
RGD: 620659
Ensembl: ENSRNOG00000047218
UniProt: Q9EPT8
Position
9q13
AA seq 251 aa
MTDSATANGDDRDPEIELFVKAGIDGESIGNCPFSQRLFMILWLKGVVFNVTTVDLKRKP
ADLHNLAPGTHPPFLTFNGDVKTDVNKIEEFLEETLTPEKYPKLAARHRESNTAGIDIFS
KFSAYIKNTKQQNNAALERGLTKALRKLDDYLNTPLPEEIDTNTHGDEKGSQRKFLDGDE
LTLADCNLLPKLHVVKIVAKKYRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELA
YADVARRLSRS
NT seq 756 nt   +upstreamnt  +downstreamnt
atgacggactcagcgacagctaatggggacgacagggaccccgagatcgagctcttcgtg
aaggctggcatcgatggagagagcattggcaactgtcctttctctcagcgtctcttcatg
atcctctggctgaaaggagtcgtgttcaacgtcaccaccgtggatctgaaaagaaagcca
gccgatctacacaacctggctcctggcacacacccgcccttcctgaccttcaatggggac
gtgaagactgatgtcaacaagattgaggagttcctggaggagaccttaacccctgagaag
taccccaaactggctgcaaggcacagggaatctaacactgcgggcatcgatatcttctcc
aagttttcagcctacatcaaaaacaccaaacagcagaacaatgctgcccttgagagaggc
ctgacaaaggcgctgaggaagctggatgactacctgaacacccctctgccagaggagatt
gacaccaacacccatggggacgagaagggctcccagcgcaagttcctggatggggatgag
ctaaccctggccgactgcaatctactgcccaaactccatgtggtcaagattgtggctaag
aagtacagaaactatgacatcccagctgagatgacaggcttgtggcggtacctcaagaat
gcctatgcacgggacgagttcaccaacacctgtgcagctgacagcgagatcgagttggcc
tacgcagatgtcgccaggcgcctcagccgatcctga

DBGET integrated database retrieval system