KEGG   Rattus norvegicus (rat): 94342Help
Entry
94342             CDS       T01003                                 

Gene name
Bag6, Bat3
Definition
(RefSeq) BCL2-associated athanogene 6
  KO
K23390  large proline-rich protein BAG6
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rno03400]
    94342 (Bag6)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  Check point factors
   BAG6-UBL4A-GET4 complex
    94342 (Bag6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BAG6 ubiquitin Rad60-SLD DUF2407 TBK1_ULD Rad60-SLD_2
Motif
Other DBs
NCBI-GeneID: 94342
NCBI-ProteinID: NP_001029140
RGD: 71064
Ensembl: ENSRNOG00000000851
Vega: OTTRNOG00000001825
UniProt: Q6MG49
Position
20p12
AA seq 1146 aa AA seqDB search
MEPSDSTSTAMEEPDSLEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLI
YQGRVLQDDKKLQDYNVGGKVIHLVERAPPQTQLPSGASSGTGSASATHGGGPLPGTRGP
GASGHDRNANSYVMVGTFNLPSDGSAVDVHINMEQAPIQSEPRVRLVMAQHMIRDIQTLL
SRMECRGGTQAQASQPPPQTPTVASETVALNSQTSEPVESEAPPREPMESEEMEERPPTQ
TPELPPSGPAPAGPAPAPETNAPNHPSPAEHVEVLQELQRLQRRLQPFLQRYCEVLGAAA
TTDYNNNHEGREEDQRLINLVGESLRLLGNTFVALSDLRCNLACAPPRHLHVVRPMSHYT
TPMVLQQAAIPIQINVGTTVTMTGNGARPPPAPGAEAASPGSGQASSLPPSSATVDSSTE
GAPPPGPAPPPATSHPRVIRISHQSVEPVVMMHMNIQDSGAQPGGVPSAPTGPLGPPGHG
QSLGQQVPGFPTAPTRVVIARPTPPQARPSHPGGPPVSGALQGAGLGTNTSLAQMVSGLV
GQLLMQPVLVAQGTPGMAPASASAPATAQAQAPAPAPAPAPAPATASASAGTTNTATTAG
PAPGGPAQPPPPQPSAADLQFSQLLGNLLGPAGPGAGGPSLASPTITVAVPGVPAFLQGM
TEFLQASQAAPPPPPPPPPPPPAPEQQTTPPPGSPSGGTASPGGLGPESLPPEFFTSVVQ
GVLSSLLGSLGARAGSSESIAAFIQRLSGSSNIFEPGADGALGFFGALLSLLCQNFSMVD
VVMLLHGHFQPLQRLQPQLRSFFHQHYLGGQEPTSSNIRMATHTLITGLEEYVRESFSLV
QVQPGVDIIRTNLEFLQEQFNSIAAHVLHCTDSGFGARLLELCNQGLFECLALNLHCLGG
QQMELAAVINGRIRRMSRGVNPSLVSWLTTMMGLRLQVVLEHMPVGPDAILRYVRRIGDP
PQALPEEPMEVQGAERTSPEPQREDASPAPGTTAEEAMSRGPPPAPEGGSRDEQDGASAD
AEPWAAAVPPEWVPIIQQDIQSQRKVKPQPPLSDAYLSGMPAKRRKTMQGEGPQLLLSEA
VSRAAKAAGARPLTSPESLSRDLEAPEVQESYRQQLRSDIQKRLQEDPNYSPQRFPNAHR
AFADDP
NT seq 3441 nt NT seq  +upstreamnt  +downstreamnt
atggagccgagtgatagtaccagtaccgctatggaggagcctgacagcctggaggtactg
gtgaagaccctggactctcagactcggacttttattgtgggggcccagatgaatgtaaag
gagtttaaggaacacatagctgcctctgtcagcatcccttccgagaaacagcggctcatc
taccagggccgggttctacaagatgacaagaagctccaggactacaatgttgggggaaag
gttatccacctggtggaacgggctcctcctcagactcagctaccttctggagcatcttct
gggacaggctctgcctcagctactcatggtgggggccccctgcctggcactcggggccct
ggggcctctggtcatgaccggaatgccaacagttatgtcatggttggaaccttcaatctt
cctagtgacggctctgctgtggacgttcacatcaacatggaacaggccccaattcagagt
gagccccgggtacggctggtgatggctcagcacatgattagggatatacagaccttactg
tcccggatggagtgtcgagggggaacccaagcacaggccagtcagccacccccgcagact
ccgactgtggcctcagagacagtagctttgaactcacaaacatcagagccagttgaaagt
gaagctcctcctcgagagcccatggagtcagaagaaatggaggaacgtcccccaacccag
actccagagcttccaccctctggcccagctccagcaggcccagcacccgcaccagagaca
aatgcacccaaccacccttcccctgcagagcacgtggaggtgctccaggagcttcagcgc
ttgcaacgccgtcttcagcccttcctgcagcgctactgtgaggtcctgggtgctgctgcc
actacagactacaataacaatcatgagggccgagaagaggaccagaggttgattaacttg
gtgggggagagcctgcggctactgggcaacactttcgtggcattgtctgatctgcgctgt
aatctagcctgtgcacccccacggcacctgcatgtggtacggcctatgtctcactacacg
actcccatggtgctccagcaggcagccattcccattcagatcaatgtggggactactgtg
accatgacaggcaatggggctcggcctccaccagctcccggtgcagaggcagcatcccca
ggttctggccaggcctcatcccttcctccatcttctgccactgttgattcatcaacggaa
ggagctcccccaccagggccagcaccaccaccagccaccagccatccacgggtcatccgg
atttcccaccagagtgtggaacctgtggtcatgatgcacatgaacattcaagactccgga
gcacagcctggaggtgtgcccagtgctcccactggccccctgggacctcctggtcatgga
cagagcctgggacagcaggtgcccggcttcccaacagcaccaactcgggtggtgattgcc
cgacccactcctccacaggctcggccttcccatcctgggggccctccagtctctggagct
ctacagggtgctgggctgggtacaaacacttcattggcccagatggtgagcggccttgtg
gggcaacttctcatgcagcctgttcttgtggctcaggggactccaggaatggctccggct
tctgcttcagctccggctacggcccaggcacaggccccggccccagccccagctccggcc
ccagctccggccactgcttcagctagtgctggcactaccaacacagccaccacagccggc
cctgctcctgggggtcccgcccagcctccacctcctcagccctctgcggctgatcttcag
ttctctcagctcctgggaaatctgctggggcctgcagggccaggggctgggggcccaagc
ctggcttctcccaccatcactgtggcagtgcctggagttcctgcttttctccagggcatg
actgagtttttgcaggcatcacaggctgcccctccaccccctccacctcctccaccccca
cctcctgctccagagcagcagaccacaccgcctccaggatccccttctggtgggacagcg
agtcctgggggcttaggtcctgagagcctgccaccagagtttttcacctcagtggtgcag
ggcgtgttgagctctctcctgggctccttgggggctcgtgctggcagcagcgagagtatt
gctgccttcatccaacgcctcagtggatccagcaacatctttgagcctggggctgatggc
gcccttggattctttggagctctgctctctcttctgtgccagaatttctccatggtggat
gtggtgatgcttctccatggccatttccagccactacagcggctccagccacagctacga
tctttcttccaccagcactacctgggtggccaggagcccacgtccagcaacatccggatg
gcaacccacacgttgatcacggggctggaagagtatgtacgggagagtttctctttggtg
caggttcagccaggtgtggatatcatccggacaaatttagaatttctccaggagcaattt
aacagcattgctgctcacgtgctgcactgtacagacagtggatttggagcccggctgctg
gagctatgtaaccagggcctgtttgaatgcttggccctgaacctgcactgcttggggggc
cagcaaatggagcttgctgctgtcatcaatggccgaattcgccgcatgtctcgtggggtg
aatccatccttggtgagctggctgacaactatgatgggactcaggcttcaggtggtctta
gagcacatgcccgtgggtcccgacgccatcctcagatatgtgcgcaggattggtgatcct
cctcaggcacttcctgaagagccaatggaagttcagggagcagaaagaacttcccctgag
cctcagagagaggatgcttccccagcccccggaacaacagcagaagaagccatgtcccga
ggtccaccccctgctcctgaaggaggttcccgagacgaacaggatggagcttcagccgat
gcagagccctgggcagctgcagtcccccctgaatgggtacctattatccagcaggacatt
cagagccagcggaaggtgaaacctcagccgcccctgagtgatgcctacctcagtggcatg
cctgccaagagacgaaagacaatgcagggtgagggcccccagctgctactctcagaggca
gtgagccgggcagctaaggcagccggagctcggcccctgacaagccccgagagcctgagc
cgggacctggaggcaccagaggttcaggagagctacaggcagcagctccggtctgatatt
caaaaacgactgcaggaagatcccaactacagcccccagcgcttccctaatgcccaccgg
gcatttgctgatgacccctag

DBGET integrated database retrieval system