KEGG   Rattus norvegicus (rat): 315509Help
Entry
315509            CDS       T01003                                 

Gene name
Jam3
Definition
(RefSeq) junctional adhesion molecule 3
  KO
K06785  junctional adhesion molecule 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04514  Cell adhesion molecules (CAMs)
rno04530  Tight junction
rno04670  Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    315509 (Jam3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    315509 (Jam3)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    315509 (Jam3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_3 I-set V-set ig Ig_2 Izumo-Ig C2-set_2 Protocadherin
Motif
Other DBs
NCBI-GeneID: 315509
NCBI-ProteinID: NP_001004269
RGD: 1303248
Ensembl: ENSRNOG00000009149
UniProt: Q68FQ2
Position
8q13
AA seq 310 aa AA seqDB search
MALSRRLRLRLCARLPDFFLLLLFRGCVIEAVNLKSSNRNPVVHEFESVELSCIITDSQT
NDPRIEWKKIQDGQTTYVYFDNKIQGDLAGRTDVFGKTSLRIWNVTRSDSAIYRCEVVAL
NDRKEVDELTIELIVQVKPVAPVCRVPKAVPVGKAATLQCQESEGYPRPYYSWYRNDVPL
PTDSRANPRFQNSSFHVNSETGTLVFSAVHKEDSGQYYCIASNDAGAARCEGQDMEVYDL
NIAGIIGGVLVVLIVLAVITMGICCAYRRGCFISSKQDGESYKSPGKHEGVNYIRTSEEG
DFRHKSSFVI
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgagccggcggctgcgacttcgcctgtgcgcgcggctacccgacttcttcctg
ctgctgctcttcaggggctgcgtgatagaggcagtgaacctcaaatccagcaaccgcaac
ccagtggttcatgaatttgaaagtgtggaattgtcttgtatcattacggactcacagaca
aatgaccctaggattgaatggaagaaaattcaagatggccaaaccacatatgtgtatttt
gacaacaagattcaaggagacctggccggtcgcacagatgtgtttggaaaaacttccctg
aggatctggaacgtgacacggtcagactcagccatctatcgctgtgaggttgttgctcta
aatgaccgaaaagaagttgatgagcttaccattgagttaattgtgcaagtgaagccagtg
gcccctgtgtgcagagttccaaaggctgtgcctgttggcaaggcagcaacactgcaatgc
caagagagcgagggctatcctcggccgtactacagctggtaccgcaatgatgtgccactg
cctacggattccagagccaatcccaggttccagaattcctccttccacgtgaactcggag
acaggcactctggttttcagtgctgtgcacaaggaagactctgggcaatattactgcatt
gcttccaatgacgcaggcgcagcccggtgtgaggggcaggacatggaagtctatgatttg
aacattgctgggattattgggggagtcctggttgtccttattgttcttgctgtgatcaca
atgggcatctgctgtgcgtacagacgaggctgcttcatcagcagtaaacaggatggagaa
agttataaaagcccagggaagcatgaaggcgttaactacatccggacaagtgaagagggt
gacttcagacacaagtcatcctttgttatctga

DBGET integrated database retrieval system