KEGG   Rattus norvegicus (rat): 24533Help
Entry
24533             CDS       T01003                                 

Gene name
Ldha, CDK1, Ldh1
Definition
(RefSeq) lactate dehydrogenase A
  KO
K00016  L-lactate dehydrogenase [EC:1.1.1.27]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno00270  Cysteine and methionine metabolism
rno00620  Pyruvate metabolism
rno00640  Propanoate metabolism
rno01100  Metabolic pathways
rno04066  HIF-1 signaling pathway
rno04922  Glucagon signaling pathway
rno05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    24533 (Ldha)
   00620 Pyruvate metabolism
    24533 (Ldha)
   00640 Propanoate metabolism
    24533 (Ldha)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    24533 (Ldha)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    24533 (Ldha)
 Organismal Systems
  Endocrine system
   04922 Glucagon signaling pathway
    24533 (Ldha)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    24533 (Ldha)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.27  L-lactate dehydrogenase
     24533 (Ldha)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   24533 (Ldha)
  Exosomal proteins of breast milk
   24533 (Ldha)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ldh_1_N Ldh_1_C Glyco_hydro_4 Pyr_redox_2
Motif
Other DBs
NCBI-GeneID: 24533
NCBI-ProteinID: NP_058721
RGD: 2996
Ensembl: ENSRNOG00000013009
UniProt: P04642 B5DEN4
Structure
PDB: 

Position
1q22
AA seq 332 aa AA seqDB search
MAALKDQLIVNLLKEEQVPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKG
EMMDLQHGSLFLKTPKIVSSKDYSVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFI
IPNVVKYSPQCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGV
HPLSCHGWVLGEHGDSSVPVWSGVNVAGVSLKSLNPQLGTDADKEQWKDVHKQVVDSAYE
VIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGIKEDVFLSVPCILGQNGI
SDVVKVTLTPDEEARLKKSADTLWGIQKELQF
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggcagccctcaaggaccagctgattgtgaatcttcttaaggaagaacaggtcccccag
aacaagattacagttgttggggttggtgctgttggcatggcttgtgccatcagtatctta
atgaaggacttggctgatgagcttgcccttgttgatgtcatagaagataagctaaaggga
gagatgatggatcttcagcatggcagccttttccttaagacaccaaaaattgtctccagc
aaagattatagtgtgactgcaaactccaagctggtcattatcaccgcgggggcccgtcag
caagagggagagagccggctcaatttggtccagcgaaacgtgaacatcttcaagttcatc
attccaaatgttgtgaaatacagtccacagtgcaaactgctcatcgtctcaaacccagtg
gatatcttgacctacgtggcttggaagatcagcggcttccccaaaaacagagttattgga
agtggttgcaatctggattcggctcggttccgttacctgatgggagaaaggctgggagtt
catccactgagctgtcacgggtgggtcctgggagagcatggcgactccagtgtgcctgtg
tggagtggtgtgaacgtcgccggcgtctccctgaagtctctgaacccgcagctgggcacg
gatgcagacaaggagcagtggaaggatgtgcacaagcaggtggttgacagtgcatacgaa
gtgatcaagctgaaaggttacacatcctgggccattggcctctccgtggcagacttggcc
gagagcataatgaagaaccttaggcgggtgcatcccatttccaccatgattaagggtctc
tatggaatcaaggaggatgtcttcctcagcgtcccatgtatcctgggacaaaatggaatc
tcagatgttgtgaaggtgacactgactcctgacgaggaggcccgcctgaagaagagtgca
gataccctctggggaatccagaaggagctgcagttctaa

DBGET integrated database retrieval system