KEGG   Rattus norvegicus (rat): 24533Help
Entry
24533             CDS       T01003                                 

Gene name
Ldha, CDK1, Ldh1
Definition
(RefSeq) lactate dehydrogenase A
  KO
K00016  L-lactate dehydrogenase [EC:1.1.1.27]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno00270  Cysteine and methionine metabolism
rno00620  Pyruvate metabolism
rno00640  Propanoate metabolism
rno01100  Metabolic pathways
rno04066  HIF-1 signaling pathway
rno04922  Glucagon signaling pathway
rno05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    24533 (Ldha)
   00620 Pyruvate metabolism
    24533 (Ldha)
   00640 Propanoate metabolism
    24533 (Ldha)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    24533 (Ldha)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    24533 (Ldha)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    24533 (Ldha)
 09160 Human Diseases
  09161 Cancers: Overview
   05230 Central carbon metabolism in cancer
    24533 (Ldha)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24533 (Ldha)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.27  L-lactate dehydrogenase
     24533 (Ldha)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   24533 (Ldha)
  Exosomal proteins of breast milk
   24533 (Ldha)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ldh_1_N Ldh_1_C Glyco_hydro_4 Pyr_redox_2
Motif
Other DBs
NCBI-GeneID: 24533
NCBI-ProteinID: NP_058721
RGD: 2996
Ensembl: ENSRNOG00000013009
UniProt: P04642 B5DEN4
Structure
PDB: 

Position
1q22
AA seq 332 aa AA seqDB search
MAALKDQLIVNLLKEEQVPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKG
EMMDLQHGSLFLKTPKIVSSKDYSVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFI
IPNVVKYSPQCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGV
HPLSCHGWVLGEHGDSSVPVWSGVNVAGVSLKSLNPQLGTDADKEQWKDVHKQVVDSAYE
VIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGIKEDVFLSVPCILGQNGI
SDVVKVTLTPDEEARLKKSADTLWGIQKELQF
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggcagccctcaaggaccagctgattgtgaatcttcttaaggaagaacaggtcccccag
aacaagattacagttgttggggttggtgctgttggcatggcttgtgccatcagtatctta
atgaaggacttggctgatgagcttgcccttgttgatgtcatagaagataagctaaaggga
gagatgatggatcttcagcatggcagccttttccttaagacaccaaaaattgtctccagc
aaagattatagtgtgactgcaaactccaagctggtcattatcaccgcgggggcccgtcag
caagagggagagagccggctcaatttggtccagcgaaacgtgaacatcttcaagttcatc
attccaaatgttgtgaaatacagtccacagtgcaaactgctcatcgtctcaaacccagtg
gatatcttgacctacgtggcttggaagatcagcggcttccccaaaaacagagttattgga
agtggttgcaatctggattcggctcggttccgttacctgatgggagaaaggctgggagtt
catccactgagctgtcacgggtgggtcctgggagagcatggcgactccagtgtgcctgtg
tggagtggtgtgaacgtcgccggcgtctccctgaagtctctgaacccgcagctgggcacg
gatgcagacaaggagcagtggaaggatgtgcacaagcaggtggttgacagtgcatacgaa
gtgatcaagctgaaaggttacacatcctgggccattggcctctccgtggcagacttggcc
gagagcataatgaagaaccttaggcgggtgcatcccatttccaccatgattaagggtctc
tatggaatcaaggaggatgtcttcctcagcgtcccatgtatcctgggacaaaatggaatc
tcagatgttgtgaaggtgacactgactcctgacgaggaggcccgcctgaagaagagtgca
gataccctctggggaatccagaaggagctgcagttctaa

DBGET integrated database retrieval system