KEGG   Rhodococcus opacus PD630: Pd630_LPD01189Help
Entry
Pd630_LPD01189    CDS       T03071                                 

Definition
(GenBank) Non-specific lipid-transfer protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
roa  Rhodococcus opacus PD630
Pathway
roa00071  Fatty acid degradation
roa00072  Synthesis and degradation of ketone bodies
roa00280  Valine, leucine and isoleucine degradation
roa00310  Lysine degradation
roa00362  Benzoate degradation
roa00380  Tryptophan metabolism
roa00620  Pyruvate metabolism
roa00630  Glyoxylate and dicarboxylate metabolism
roa00640  Propanoate metabolism
roa00650  Butanoate metabolism
roa00900  Terpenoid backbone biosynthesis
roa01100  Metabolic pathways
roa01110  Biosynthesis of secondary metabolites
roa01120  Microbial metabolism in diverse environments
roa01130  Biosynthesis of antibiotics
roa01200  Carbon metabolism
roa01212  Fatty acid metabolism
roa02020  Two-component system
Brite
KEGG Orthology (KO) [BR:roa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Pd630_LPD01189
   00630 Glyoxylate and dicarboxylate metabolism
    Pd630_LPD01189
   00640 Propanoate metabolism
    Pd630_LPD01189
   00650 Butanoate metabolism
    Pd630_LPD01189
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Pd630_LPD01189
   00072 Synthesis and degradation of ketone bodies
    Pd630_LPD01189
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Pd630_LPD01189
   00310 Lysine degradation
    Pd630_LPD01189
   00380 Tryptophan metabolism
    Pd630_LPD01189
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Pd630_LPD01189
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Pd630_LPD01189
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Pd630_LPD01189
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:roa04147]
    Pd630_LPD01189
Enzymes [BR:roa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Pd630_LPD01189
Exosome [BR:roa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Pd630_LPD01189
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Peptidase_M22 SpoVAD
Motif
Other DBs
NCBI-ProteinID: AHK28423
UniProt: W8H5L4
Position
complement(1200868..1202043)
Genome map
AA seq 391 aa AA seqDB search
MANQLAAVLGTGQTHYVAKRHDVSMAGLVREAIDRAMDDARVGWDDIDAVVIGKAPDLFE
GSMMPELAMSDALGANGKPLLRVHTAGSVGGSTAVVASSLVKSGVHKRVLTVAWEKQSES
NAMWALSTPIPFHMPVGAGAGGYFAPHVRSYIRRSGAPDHIGAMVAVKDRLNGSLNPYAH
LKQPDITLESVQASQMLWDPIRYDETCPSSDGACAMVIGNEEAAEQVTADGREVAWIHAT
AMRTEPTTFAGRDQVNPQAGRDAAAALWKAAGIKDPLDEIDVAEIYVPFSWFEPMWLENL
GFVSEGEGWKLTEAGETAIGGRLPLNASGGVLSSNPIGASGMIRFAESAMQVMHRAGDHQ
VKDARKALGHAYGGGSQYFSMWVVGSDRPNN
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcgaatcaattggccgcggtgctcggcaccggtcagacgcattacgtcgcgaagcgg
cacgacgtgtccatggcggggctggttcgcgaggcgatcgaccgcgcgatggacgacgcc
cgggtgggctgggacgacatcgacgcggtcgtgatcgggaaggcccccgacctcttcgag
gggtcgatgatgccggagctcgcgatgtcggacgcgctgggcgccaacggcaaaccactc
ctgcgtgtgcacaccgcaggctcggtcggcggttcgaccgcggtggtggcgtcgagcctc
gtgaagtcgggggtgcacaagcgggtgctgacggtggcgtgggagaagcagtccgagtcg
aacgccatgtgggcgctgtccacccccattccgttccacatgccggtcggcgcgggcgcg
ggcggctacttcgccccgcacgtccgctcgtacatccggcggtcgggcgcacccgatcac
atcggcgcgatggtggcggtgaaggaccggctgaacggcagcctcaacccgtacgcccac
ctcaagcaacccgacatcacgctcgaatccgtgcaggcctcgcagatgctgtgggatccc
atccgctacgacgagacgtgtccgtcctcggacggcgcctgcgcgatggtgatcggcaac
gaggaggcggccgagcaggtcacggcggacggtcgtgaggtggcctggatccacgccacc
gcgatgcgcaccgagcccaccacgttcgcgggacgcgaccaggtgaatccgcaggccggc
cgggacgccgcggcggcactgtggaaggccgcgggcatcaaggatccgctcgacgagatc
gacgtggcggaaatctacgtccccttctcctggttcgaaccgatgtggctcgagaatctg
gggttcgtctccgagggcgagggctggaagctgaccgaggccggcgagacggccatcggc
ggccggcttccgctcaacgcgtccggcggcgtcctgtcgtccaatcccatcggcgcctcg
ggcatgatccggttcgccgagtcggcgatgcaggtgatgcaccgcgccggcgaccatcag
gtgaaggacgcacgcaaggcactcggccacgcctacggcggcggttcgcagtacttctcg
atgtgggtggtcggttccgaccggccgaacaattag

DBGET integrated database retrieval system