KEGG   Rhodococcus opacus PD630: Pd630_LPD04419Help
Entry
Pd630_LPD04419    CDS       T03071                                 

Definition
(GenBank) Putative aldehyde dehydrogenase family 7 member A1
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
roa  Rhodococcus opacus PD630
Pathway
roa00010  Glycolysis / Gluconeogenesis
roa00053  Ascorbate and aldarate metabolism
roa00071  Fatty acid degradation
roa00280  Valine, leucine and isoleucine degradation
roa00310  Lysine degradation
roa00330  Arginine and proline metabolism
roa00340  Histidine metabolism
roa00380  Tryptophan metabolism
roa00410  beta-Alanine metabolism
roa00561  Glycerolipid metabolism
roa00620  Pyruvate metabolism
roa00625  Chloroalkane and chloroalkene degradation
roa00903  Limonene and pinene degradation
roa01100  Metabolic pathways
roa01110  Biosynthesis of secondary metabolites
roa01120  Microbial metabolism in diverse environments
roa01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:roa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pd630_LPD04419
   00053 Ascorbate and aldarate metabolism
    Pd630_LPD04419
   00620 Pyruvate metabolism
    Pd630_LPD04419
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Pd630_LPD04419
   00561 Glycerolipid metabolism
    Pd630_LPD04419
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Pd630_LPD04419
   00310 Lysine degradation
    Pd630_LPD04419
   00330 Arginine and proline metabolism
    Pd630_LPD04419
   00340 Histidine metabolism
    Pd630_LPD04419
   00380 Tryptophan metabolism
    Pd630_LPD04419
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Pd630_LPD04419
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Pd630_LPD04419
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Pd630_LPD04419
Enzymes [BR:roa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Pd630_LPD04419
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AHK31632
UniProt: W8H0M2
Position
complement(4631552..4633108)
Genome map
AA seq 518 aa AA seqDB search
MSTAVAETIALPTTDELRTLARTSLQRCGVDPAVLDTAGVENTITARTPVTGESLFDYPA
ADAADVEAAIDAAHEAFLQWRTVPGPVRGFLIKRLGELLTEHKEDVANLISIEVGKIRSE
ALGEVQEMIDICDFAVGLSRQLDGRTMPSERPGHRLMETWHPLGVVGVVSAFNFPAAVWS
WNLALAIVCGDSVIWKPAQLTTLTAAACSALFDRAAEESGAPANLNVLVSASAADTQALI
DSPKVPLISATGSERMGEQIAPRVAARFGRAILELGGNNAAIVTPSADLDIATRGIVFAA
AGTAGQRCTSMRRIIVHQDIADELIDRISQVYGRLPIGDPFADGTLVGPLIDGKSHANMT
AALDKAVAQGGEILVGGKRRPSSEDSYYVEPAIVRMPAQSEIVKDETFAPILYVLTYNTF
EEAIALHNDVPQGLSSSIFTTDQREAERFIAADGSDCGIVNVNIGTSGAEIGGAFGGEKT
TGGGRESGSDAWRAYMRRATNTINYSRELPLAQGVNFG
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgctgtcgccgagaccatcgccctgcccaccacggacgaactgcgcactctc
gcacgcaccagcctgcagcgatgtggggtcgacccggccgtactcgataccgccggggtc
gagaacaccatcaccgcccgcaccccggtcacgggggagagcctcttcgactatcccgcc
gccgacgccgcggatgtcgaggccgcgatcgatgccgcccacgaggcgttcctgcagtgg
cgcaccgttcccggcccggtccgcgggttcctgatcaagcggctcggcgaactgctcacc
gagcacaaggaagacgtcgccaacctgatcagcatcgaggtcggcaagatccgctcggag
gcactcggcgaggtccaggaaatgatcgacatctgcgacttcgcggtcggtctgtcccgg
cagctcgacggccgcaccatgccctcggagcgtcccggacaccgactgatggagacgtgg
cacccgctcggtgtcgtcggtgtcgtctcggcgttcaacttcccggccgcggtgtggtcg
tggaaccttgctcttgccatcgtctgcggggattcggtgatctggaagccggcgcagctg
accaccctcaccgccgccgcatgctcggcgctgttcgaccgtgccgcagaagaatccggc
gccccggccaacctgaatgtcctcgtctcggcgagtgccgccgacacccaggccctgatc
gacagcccgaaggtgcctttgatcagcgccaccggttccgagcggatgggtgagcagatc
gctccccgcgtcgccgcccggttcggccgtgccatcctcgagctcggcggaaacaacgct
gcgatcgtcaccccgtcggcggacctcgacatcgctacccgcggaatcgttttcgccgct
gccgggaccgccggtcagcgctgcacctcgatgcgccgcatcatcgtccaccaggacatc
gccgacgagctgatcgaccggatttcccaggtctacggccgactcccgatcggtgacccg
ttcgccgacggcaccctcgtgggcccgctgatcgacggcaagtcccacgccaacatgacc
gcagccctcgacaaggccgtcgcgcagggcggcgagatcctcgtcggcggaaaacgccgc
ccgagcagcgaagactcgtactacgtcgagccggcgatcgtgcggatgccggcccagagc
gagatcgtcaaggacgaaaccttcgccccgatcctctacgtgctgacctacaacacgttc
gaggaagcgatcgccctgcacaacgacgtcccgcagggcctgtcgtcgtcgatcttcacc
accgaccagcgtgaggccgagcggttcatcgcagctgacggttcggactgcggcatcgtc
aacgtcaacatcggcacgtccggcgccgagatcggcggcgcgttcggcggcgagaagacc
accggcggcggccgcgaatccggctcggacgcttggcgcgcctacatgcgccgggcgacc
aacaccatcaactactcccgcgagctgcccctggctcagggcgtcaacttcggctga

DBGET integrated database retrieval system