KEGG   Rhodococcus opacus PD630: Pd630_LPD05772Help
Entry
Pd630_LPD05772    CDS       T03071                                 

Definition
(GenBank) (R,R)-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
roa  Rhodococcus opacus PD630
Pathway
roa00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:roa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Pd630_LPD05772
Enzymes [BR:roa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     Pd630_LPD05772
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     Pd630_LPD05772
    1.1.1.-  
     Pd630_LPD05772
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc ADH_zinc_N_2 FAD_binding_3 AdoHcyase_NAD 2-Hacid_dh_C AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AHK32963
UniProt: W8HIQ4
Position
5948856..5949911
Genome map
AA seq 351 aa AA seqDB search
MRAARFHGRRDIRIDDIPEPELRPGAVKLRVAWCGICGTDLHEYLEGPIFISPPGHPHPL
SHENAPVTMGHEFSGTVEEVGEGVTDVAVGDNVVVEPYFVCNECASCKAGNYHLCTKMGF
IGLAGGGGGLSEKVVVDRRWVHKIGDIPLDEAALIEPLSVAHHAVVRSGAKAGDVALVGG
AGPIGLLVAAVLKGLGVTTIVTELSDARKQKALSSGVAHHVIDPSSEDVKARVLELTDGV
GADLGFECAGVDVVLDTILDAVRPAAVVVNVSIWGKPATVDMQKLVLKEIDLRGTIAYVR
DHEAVIEMVRSGVIDLAPFITGRIELDNLVSEGLTTLIEHNDTAVKILVRA
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgagggcagcacgcttccacggccgacgcgacatccggatcgacgacatcccggagccg
gaattgcggccgggcgcggtgaaactccgggtcgcgtggtgcggcatctgtggcaccgat
ctgcacgagtacctggaaggcccgattttcatctccccgccgggacatccgcatccgctg
tcgcacgagaacgcgccggtgacgatgggccacgagttctccggcacggtggaggaggtc
ggcgagggcgtcaccgatgtcgccgtgggcgacaacgtggtggtggagccgtacttcgtg
tgtaacgagtgcgcgtcctgcaaggcaggcaactatcacctgtgcacgaagatgggtttc
atcggattggccggtggcggaggcggactcagcgagaaggtggtggtcgaccgccggtgg
gtgcacaagatcggtgacatcccgctcgacgaggcggccctgatcgaaccgctcagcgtc
gcgcaccatgcggtcgtccgcagcggggcgaaggccggcgacgtcgcgctggtcggtggt
gcggggccgatcggactcctcgtggccgcggtcctgaagggtctgggtgtcaccacgatc
gtcacggaactcagtgacgcccggaagcagaaggcgctgtccagcggcgtcgcgcatcac
gtgatcgacccgtcgtcggaggacgtgaaggcccgggtgctcgagctgaccgacggtgtc
ggcgcggatctcgggttcgagtgcgccggggtcgacgtcgtcctcgacaccatcctcgac
gccgtccggcccgcagccgtggtggtgaatgtgtcgatctggggcaagcccgcgacggtc
gacatgcagaagctcgtcctcaaggagatcgacctgcgcggcaccatcgcctacgtccgc
gatcacgaggcggtgatcgagatggtgcgcagcggcgtgatcgacctcgccccgttcatc
accgggcggatcgaactcgacaatctggtctcggagggcctcacgacgttgatcgagcac
aacgacacggcggtgaagatcctggtccgggcgtga

DBGET integrated database retrieval system