KEGG   Rhodococcus opacus PD630: Pd630_LPD06341Help
Entry
Pd630_LPD06341    CDS       T03071                                 

Definition
(GenBank) Phosphatidylserine decarboxylase proenzyme
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
roa  Rhodococcus opacus PD630
Pathway
roa00564  Glycerophospholipid metabolism
roa01100  Metabolic pathways
roa01110  Biosynthesis of secondary metabolites
Module
roa_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:roa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Pd630_LPD06341
Enzymes [BR:roa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     Pd630_LPD06341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: AHK33528
UniProt: W8HKD1
Position
6554166..6554879
Genome map
AA seq 237 aa AA seqDB search
MARKPTPPGTPQSTSVGHIVDLVRGAVPPLHPAGLPFVLAPLGVAVLGRKRKWVRRGALT
SAAACAAFFRHPHRVPPNRVGVVVAPADGEVALVDSAVPPSELDMGTEPLPRVSIFLSVL
DVHVQRSPVGGEVTKVVHRPGQFLSADLADASEVNERNSMLLHTPEGHDVAVVQIAGLLA
RRIVCDAKVGDTLPIGDTYGLIRFGSRVDTYFPAGTTLLAERGQRTIGAETVIAQLP
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
gtggcacgcaagcccacaccccccggaaccccgcaatccacgagcgtcgggcacatcgtc
gacctcgtccgcggagcagttccgcccctgcatccggccgggctgcccttcgtcctcgcg
ccgctcggtgtggccgtcctcggccgcaagcgcaagtgggtccggcgtggagcgctgacc
tccgccgcagcatgcgccgcgttcttccggcatccccaccgcgttccgccgaaccgtgtc
ggcgtcgtggtcgcacccgccgacggcgaggtcgctctcgtcgactccgcggtcccgccg
tccgaactcgacatgggcaccgagccgctcccccgggtcagcatcttcctgtccgtgctc
gacgtgcacgtccagcgcagtcctgtcggtggagaggtcacgaaggtcgtccaccggccg
ggccagttcctctccgccgatctcgccgacgccagcgaggtcaacgaacgcaacagcatg
ctgctgcacaccccggagggccacgacgtcgccgtcgtgcagatcgccggtctgctcgcc
cgccggatcgtctgcgacgccaaggtcggcgacaccctcccgatcggtgacacgtatggc
ctgatccggttcggctcccgcgtcgacacgtacttcccggcgggcaccacgttgctcgcc
gagcgggggcagcggacgatcggtgccgagaccgtcatcgctcaactgccgtga

DBGET integrated database retrieval system