KEGG   Blautia obeum: CK5_24650Help
Entry
CK5_24650         CDS       T02605                                 

Definition
(GenBank) glutamate-1-semialdehyde 2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
rob  Blautia obeum
Pathway
rob00860  Porphyrin and chlorophyll metabolism
rob01100  Metabolic pathways
rob01110  Biosynthesis of secondary metabolites
rob01120  Microbial metabolism in diverse environments
Module
rob_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:rob00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CK5_24650
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rob01007]
    CK5_24650
Enzymes [BR:rob01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     CK5_24650
Amino acid related enzymes [BR:rob01007]
 Aminotransferase (transaminase)
  Class III
   CK5_24650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 OmpH
Motif
Other DBs
NCBI-ProteinID: CBL23775
UniProt: D4LSL7
Position
2507203..2508480
Genome map
AA seq 425 aa AA seqDB search
MGKSEELFERAVKRIPGGVNSPVRAYGAIGMAPRFIKRADGCHIYDVDGNEYVDYIDSWG
PMILGHNFPQIREAVVEACADGLSFGCATEIEVEMAEFICEHLPHVEMVRMVNSGTEAVM
SAIRAARGYTGRDKIIKFAGCYHGHSDALLVSAGSGVMTSGVPDSAGVPKGCTQDTMTAV
YNDLNSVKTLLEQAPGQVAAVIVEPVAANMGVVPPKKGFLEGLRSLCTEHGTLLIFDEVI
TGFRLAFGGAAEYFGVTPDMVTFGKIIGAGMPVGAYGGRKEIMEMVSPAGPVYQAGTLSG
NPIAMAAGLTQLKYLYEHQEVYKELEEKGEKLYSGIEQILKEYKKPYHVNYVSSLGSLFF
AENEVVDYTSAKASDTNAFADYFLAMLKSGIHLAPSQFEAMFLSAAHTDTVIEETLSEVR
DYFMK
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaatcagaagaattatttgaacgtgcagtaaaaagaattccgggcggcgtcaac
agtccggtcagagcgtatggtgcgatcggaatggctccgagatttatcaaacgtgcagat
ggctgtcacatttatgatgtagatggcaatgaatacgtagattatatcgattcctgggga
ccgatgatcctcggtcataacttcccgcagatccgggaagcagtagttgaagcatgtgca
gacggtctgagctttggatgtgctacagagatagaagtagagatggcggaatttatctgt
gaacatcttccgcatgttgagatggtgcgtatggtcaattccggcacagaagctgttatg
agtgcaattcgtgcggcaaggggatatacgggtcgcgataagatcatcaaatttgccggc
tgttatcatggacacagtgatgcacttctggtaagtgccggttccggtgtgatgacaagt
ggtgtaccggacagtgccggagtaccaaaaggctgcacacaggataccatgacagcagtt
tataatgatctgaacagcgtaaaaacacttctggaacaggcaccgggacaggtggctgcg
gtgattgtagaaccggttgcagccaatatgggtgtggttccgccaaagaagggattcctg
gaaggtcttcgcagtctctgtaccgagcacggaacattactgatctttgatgaagttatt
acaggattccgacttgcatttggcggggcggcagagtattttggcgtgacaccggatatg
gttacctttggtaaaatcattggggcaggaatgcctgttggtgcttatggcggaagaaag
gaaatcatggaaatggtttctccggcaggcccggtttatcaggcaggaactttaagtggt
aatccgattgcaatggccgcaggtctgacacagctgaaatatctgtatgaacatcaggaa
gtttataaggaactggaagaaaagggcgaaaaactttatagtggaatcgaacagattctt
aaagaatataaaaagccgtatcatgtaaattatgtttcatctttaggaagtctgtttttt
gcagaaaatgaagtagttgattatacaagtgcaaaggcttctgatacaaatgcatttgca
gattattttcttgcaatgttgaaatcaggaattcatctggcaccgtctcagtttgaggca
atgtttctttcagccgcgcatacagatactgtgatcgaagagacactttctgaagtacga
gattattttatgaaataa

DBGET integrated database retrieval system