KEGG   Blautia obeum: CK5_30690
Entry
CK5_30690         CDS       T02605                                 

Definition
(GenBank) Aerobic-type carbon monoxide dehydrogenase, small subunit CoxS/CutS homologs
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
rob  Blautia obeum
Pathway
rob00230  Purine metabolism
rob01100  Metabolic pathways
rob01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rob00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CK5_30690
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: CBL24295
UniProt: D4LU37
Position
complement(3105883..3106365)
AA seq 160 aa
MKKEKILVQCVVNGEEVAEYVDPRESLLDMLRNHLGLTSVKRGCEVGECGACTVIIDGET
IDSCIYLAVWAEGKNIRTLEGLEKNGELTRIQEAFIEEGAVQCGFCTPGFIMSATVLLEQ
GKELTREEIKKKMSGNLCRCTGYQNIVNAVEKVMHERNDS
NT seq 483 nt   +upstreamnt  +downstreamnt
atgaaaaaagaaaaaatacttgttcagtgcgtggtaaacggagaagaagtggcagagtat
gttgatccgagagaatctcttctggatatgcttcgtaatcacctcgggctgacctctgta
aagagaggctgtgaagtcggagagtgtggcgcctgtactgtgatcatcgatggtgaaacc
attgattcctgtatttatctggcggtctgggcggagggcaaaaacatccgtacactggaa
ggcctggaaaaaaacggtgaactgacacggatccaggaagcgtttattgaggaaggcgcg
gtgcagtgcgggttctgcacaccgggatttatcatgtctgcaacggttctgctggagcag
ggaaaagaactgaccagagaagaaatcaagaaaaaaatgtccggaaatctctgccgctgt
acgggataccagaatatcgtcaatgcggtagaaaaagtgatgcatgaaaggaatgacagc
tga

DBGET integrated database retrieval system