KEGG   Blautia obeum: CK5_34040Help
Entry
CK5_34040         CDS       T02605                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rob  Blautia obeum
Pathway
rob00071  Fatty acid degradation
rob00280  Valine, leucine and isoleucine degradation
rob00310  Lysine degradation
rob00362  Benzoate degradation
rob00380  Tryptophan metabolism
rob00620  Pyruvate metabolism
rob00630  Glyoxylate and dicarboxylate metabolism
rob00640  Propanoate metabolism
rob00650  Butanoate metabolism
rob00900  Terpenoid backbone biosynthesis
rob01100  Metabolic pathways
rob01110  Biosynthesis of secondary metabolites
rob01120  Microbial metabolism in diverse environments
rob01130  Biosynthesis of antibiotics
rob01200  Carbon metabolism
rob01212  Fatty acid metabolism
rob02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rob00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CK5_34040
   00630 Glyoxylate and dicarboxylate metabolism
    CK5_34040
   00640 Propanoate metabolism
    CK5_34040
   00650 Butanoate metabolism
    CK5_34040
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CK5_34040
   00072 Synthesis and degradation of ketone bodies
    CK5_34040
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CK5_34040
   00310 Lysine degradation
    CK5_34040
   00380 Tryptophan metabolism
    CK5_34040
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CK5_34040
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CK5_34040
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CK5_34040
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rob04147]
    CK5_34040
Enzymes [BR:rob01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CK5_34040
Exosome [BR:rob04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CK5_34040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CBL24591
UniProt: D4LUY3
Position
3482735..3483928
Genome map
AA seq 397 aa AA seqDB search
MGEFKDVVIVSGCRTAVGSYGGSLKGVSAIDLGAIVVKEAVNRAGIKPSDVDEVIIGQVG
EVAENGFVARAISLKSGMPKETTAYSVNRQCGSSLQSIADAVMEIQTGFADVVVAGGAEN
ISQLPYYVKDARWGARMGHKVFEDGVIDILTWPLDGNHNGVTAENVATKYDVTREEQDAF
AMQSHQRACAAIKAGKFKAEIVPVELKDRKGNVTIFDTDEGPREGQTMEKLAKLRPCFVK
GGTVTAGNSSSLNDAAAAVVVMSREKAEELGVIPKLVIKGWTVAGFDAELMGYSPKLSSE
KLAKQLNLNLKDIDMFEINEAFASQAVAVSRDLGLDMDKVNIYGGGISIGHPIGATGCIL
TVKVMYELMRTDKKNAMISMCIGGGQGISMYVEKCEG
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgggtgagtttaaagatgtagtaattgtcagtggatgcagaacagccgttggttcttat
ggtggaagccttaaaggagtatctgctattgatcttggtgcgattgtagtcaaagaagct
gttaatcgtgcaggaatcaaaccttcagatgttgatgaagttattatcggacaggttgga
gaagttgcagaaaacggattcgtagcaagagcaatcagcctgaaatccggtatgccgaag
gaaacaaccgcttattccgtaaacagacagtgtggttcttccttgcagtccatcgcagat
gctgttatggagatccagacaggatttgctgatgtagttgttgctggtggtgcagagaat
atttctcagcttccatattatgtaaaagatgcccgctggggtgcacgtatgggacacaaa
gtattcgaggatggagtcatcgatatcctgacctggccattggatggaaatcacaatggt
gtaactgcagaaaacgttgcaactaaatacgatgtaacaagagaagagcaggatgctttt
gcgatgcagagccatcagagagcatgcgcagcaatcaaagcaggtaaatttaaggctgag
attgttccggtagaactgaaagaccgcaagggcaatgtaacaatttttgatacagacgag
ggtccgagagaaggacagactatggaaaaacttgcaaaactccgtccatgtttcgtaaaa
ggtggcacagttacagcaggaaactcttccagtcttaatgatgcggcagcagcagttgtt
gttatgtcaagagaaaaagcagaagaacttggtgttattccgaaacttgtcatcaaaggc
tggacagttgccggatttgatgcagagttaatgggttattcaccgaaactttccagtgaa
aaacttgcaaaacagctgaacctgaaccttaaagacattgatatgtttgagatcaatgag
gcatttgccagccaggcagtagctgtcagcagagatcttggactggatatggacaaagtt
aatatttatggtggtggtatttctatcggacacccaatcggagcaacaggctgtatcctt
acagttaaggtaatgtatgaactgatgcgtacagataagaagaatgcaatgatcagcatg
tgcatcggcggtgggcagggaatttccatgtacgttgaaaaatgtgagggctaa

DBGET integrated database retrieval system