KEGG   Roseovarius sp. AK1035: RAK1035_0234Help
Entry
RAK1035_0234      CDS       T05517                                 

Definition
(GenBank) 6-hexanolactone hydrolase
  KO
K14731  epsilon-lactone hydrolase [EC:3.1.1.83]
Organism
rok  Roseovarius sp. AK1035
Pathway
rok00903  Limonene and pinene degradation
rok00930  Caprolactam degradation
rok01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rok00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RAK1035_0234
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    RAK1035_0234
Enzymes [BR:rok01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.83  monoterpene epsilon-lactone hydrolase
     RAK1035_0234
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 Say1_Mug180 COesterase
Motif
Other DBs
NCBI-ProteinID: AWZ18945
Position
228604..229482
Genome map
AA seq 292 aa AA seqDB search
MSWQLRLLNRQLRWFEKPALARHDKDRLRRSFAFKSRLYFHAPFGSSFLRDTLDGVPVQW
ARARAARPAPVILYFHGGAYVFGTSSTHRAMLAKLSALTGLPACLPDYRLAPEHPFPAQI
ADALAAYRALRAKQEVIIGGDSAGGGLALALLHEILAQGLAPPLGVFAFSPLTDVTYSGA
SVTENAARDCVLSASRVGEMLEMFLRGQDPRDPRASPLFGVFSGAPPVWMTVGDTEILRD
DTLRMQAALVAQGVQCTLTVAPDHPHVWPIFHNVLPEARSTLRDLAAWISSL
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgagctggcagctgcgcctcttgaaccgccagttgcgctggttcgagaagccggcgctg
gcgcgccatgacaaggaccgcctccggcggtcctttgcgttcaaatcgcggctttatttt
catgccccctttggcagttcctttctgcgtgacacccttgatggggtgccggtgcaatgg
gcgcgggcccgcgctgcgcgacctgcgcccgtgatcctctatttccatggcggggcctat
gtctttggcacctcgagcacgcatcgggcgatgctggccaagctctcggcgctgaccggg
ctgcccgcctgcttgcccgattaccggctggcccccgagcatccttttccggcgcagatc
gcggatgcgctggccgcataccgcgcgctgagggccaagcaggaggtgatcatcggtggc
gatagcgcgggcggcgggctggcgctcgcgctcttgcatgaaatccttgcacagggtctt
gccccgcccttgggcgtctttgccttttcgccccttaccgatgtgacctattccggcgcg
tccgtcaccgagaatgccgcgcgcgactgcgtgctatcggccagccgggtcggcgagatg
ctggagatgttcttacgcgggcaagacccgcgcgacccgcgcgcctcgccgctttttggt
gtgttcagcggcgcgccgcccgtgtggatgaccgtgggcgacaccgagatcctgcgcgat
gatacgctgcggatgcaggccgcgctggtggcgcagggggtgcagtgcacactcaccgtc
gcgcccgatcatccgcatgtctggccaattttccacaatgtcctgcccgaggcgcgcagc
accctgcgcgatctggccgcctggatcagctctctttga

DBGET integrated database retrieval system