KEGG   Roseovarius sp. AK1035: RAK1035_0317Help
Entry
RAK1035_0317      CDS       T05517                                 

Definition
(GenBank) Succinyl-CoA:3-ketoacid-coenzyme A transferase subunit A
  KO
K01028  3-oxoacid CoA-transferase subunit A [EC:2.8.3.5]
Organism
rok  Roseovarius sp. AK1035
Pathway
rok00072  Synthesis and degradation of ketone bodies
rok00280  Valine, leucine and isoleucine degradation
rok00650  Butanoate metabolism
rok01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rok00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    RAK1035_0317
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    RAK1035_0317
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RAK1035_0317
Enzymes [BR:rok01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     RAK1035_0317
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans
Motif
Other DBs
NCBI-ProteinID: AWZ19028
Position
305164..305859
Genome map
AA seq 231 aa AA seqDB search
MNKVYGSAAEALDGLLRDDMLIAAGGFGLCGIPELLLAAIRDSGVKDLTFASNNAGVDDF
GIGILLQTRQVRKMMSSYVGENAEFMRQYLSGELELEFNPQGTLAERMRAGGCGIPGFYT
KTGVGTQVAEGKEHKEFNGETYILERGIFADLSIVKAWKADTTGNAIFRKTARNFNPPAA
MCGKVCVLEVEEIVQPGELDPDKIHLPGIYVHRLVQGTHEKRIEQRTVRAA
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaggtttacggctcggccgccgaagcgctggacgggctcttgcgtgacgacatg
ctgatcgcagcgggcggctttggcctctgcggcattcccgaattgctcttggccgcgatc
cgcgactcgggcgtcaaggatctgacctttgccagcaacaatgcgggcgtggatgatttc
ggcatcggtatcctgctgcaaacgcggcaagtgcgcaaaatgatgtcctcttatgtgggc
gagaatgccgaattcatgcgccaatatctgagcggcgagcttgagctggaattcaaccca
cagggcacgctggccgagcggatgcgcgcgggcggctgcggcattccgggtttctacacc
aagaccggcgtcggcacccaggtggccgagggcaaggaacataaagagttcaacggcgag
acctatattctcgaacgcggcatctttgccgacctctctatcgtcaaggcgtggaaggcc
gacaccaccggcaacgccatcttccgcaagacggcgcgcaacttcaacccgcctgccgcc
atgtgcggcaaggtctgcgtgctggaggtcgaggaaatcgtgcaaccgggcgaattggac
cccgacaaaatccacctgccgggcatctatgttcaccgcttggtgcagggcacgcatgag
aaacgtatcgaacaacgcaccgtgagggcagcataa

DBGET integrated database retrieval system