KEGG   Roseovarius sp. AK1035: RAK1035_0337Help
Entry
RAK1035_0337      CDS       T05517                                 

Definition
(GenBank) Methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
rok  Roseovarius sp. AK1035
Pathway
rok00450  Selenocompound metabolism
rok00970  Aminoacyl-tRNA biosynthesis
rok01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rok00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    RAK1035_0337
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    RAK1035_0337
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rok01007]
    RAK1035_0337
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rok03016]
    RAK1035_0337
Enzymes [BR:rok01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     RAK1035_0337
Amino acid related enzymes [BR:rok01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   RAK1035_0337
Transfer RNA biogenesis [BR:rok03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    RAK1035_0337
 Prokaryotic type
   Other AARSs
    RAK1035_0337
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 Anticodon_1
Motif
Other DBs
NCBI-ProteinID: AWZ19048
Position
323600..325318
Genome map
AA seq 572 aa AA seqDB search
MARHLITSAIPYINGIKHLGNLVGSQLPADLFARYCRARGHEVLFLCATDEHGTPAELAA
AKAGQPVADYCAEMHAVQAEIARGFRLSFDHFGRSSSSQNRRLTQNFAKRLHDKGLIREV
SETQMYSPTDGRYLPDRYIEGTCPNCGYESARGDQCDNCTKQLDPVDLINPRSAVSGATD
LEMRETKHLYLRQSQMKDELEAWIDSKTDWPILTTSIAKKWLNDGDGLQDRGITRDLDWG
IPVQFDDAPWQGMDGKVFYVWFDAPIEYIACGAEWAEAHGLEASAWERWWRTDKGADDVR
YTQFMGKDNVPFHTLSFPATILGSAEPWKLVDYIKSFNYLNYDGGQFSTSRGRGVFMDQA
LEILPADYWRWWLLSHAPESSDSEFTWENFQASVNKDLADVLGNFVSRVTKFCRSKFGEV
VPTGGAYGAQETALIERLTTRIREYEAHMQAMEVRKSASALRAIWVEGNEYLQEAAPWST
FKADPERAAMQTRLALNLIRLYAVLSAPFIPDAAAAMLTAMQTDDDNWPDDVPAALEMLG
ANHAFTTPDVLFSKITDEAREDWQTRFSGIRT
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atggcacggcatctcatcacctcggcgatcccctacatcaacgggatcaagcacctcggc
aatctcgtaggctcgcaacttcccgccgatctctttgcccgctactgccgcgcccgcggc
cacgaggtgctgtttctctgcgccacagacgagcatggcacccccgctgaattggcagcc
gccaaggcaggccagccagtcgcggactattgcgccgaaatgcacgccgttcaggccgaa
atcgcgcgcggttttcgcctcagctttgaccatttcgggcgctcctcctcatcccagaac
cgccgcctgacccagaatttcgccaagcgcctgcatgataaagggctgatccgagaagtc
tcggaaacgcagatgtattcgcccaccgacgggcgctacctgccagaccgctatatcgag
ggcacctgcccaaattgcggctacgagagcgcgcggggcgaccaatgcgacaactgcacc
aaacagcttgacccggtcgatctgatcaacccgcgctcagcggtatcgggcgccaccgat
ctcgagatgcgcgagaccaagcatctctacctgcgccagtcacagatgaaagacgagctt
gaggcttggatcgacagcaagaccgactggccaatcctcaccacctccattgccaagaaa
tggctcaatgacggcgatggcttgcaggatcgcggcattacccgcgatcttgactggggc
attccggtgcagttcgacgacgccccgtggcaggggatggacggcaaggttttctacgtt
tggttcgatgccccgatcgaatacatcgcctgtggggccgaatgggccgaggcgcatggg
cttgaggcctccgcttgggaacgctggtggcgcaccgacaagggggctgacgatgtccgc
tatacgcaattcatgggcaaggacaatgtgcccttccacacgctcagctttcccgccacg
atcctgggttccgcagagccgtggaagctggtcgactacatcaaatccttcaactacctc
aactacgacggcggccagttcagcacgtcgcgcgggcgcggcgtcttcatggatcaggcg
ctcgagatcctgcccgccgattactggcgctggtggttgctcagccatgcacccgaaagc
tcggacagcgagtttacatgggagaattttcaggcatcggtgaacaaggaccttgccgac
gttctgggcaatttcgtgtcccgcgtgaccaaattctgccgctcgaaattcggcgaggtg
gtgccaacgggcggcgcttatggcgcgcaggaaacagcgctgatcgagcggctcacaacc
cgcatccgcgaatatgaagcccatatgcaagcgatggaggtgcgcaaatccgcaagcgcc
ttgcgcgccatctgggttgagggcaacgagtacctgcaagaagcagccccttggtctacc
ttcaaagcagaccccgaacgcgccgccatgcaaacgcgcctcgcgctcaacctcatccgc
ctttacgccgtcctcagcgcgcccttcatccccgatgccgccgccgccatgctgaccgcg
atgcagacggatgatgacaattggcccgacgatgtgcctgccgccctcgaaatgctcggc
gccaaccacgccttcacaacccccgatgtgctcttttccaagattaccgacgaggcccgc
gaagattggcaaacccggttttcggggatacgcacctaa

DBGET integrated database retrieval system